Rabbit anti-Human MGST3 Polyclonal Antibody | anti-MGST3 antibody

MGST3 (Microsomal Glutathione S-transferase 3, Microsomal GST-3, Microsomal GST-III) (HRP)

Cat. Num. AAA6385427

• Gene Names: MGST3; GST-III
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MGST3; Polyclonal Antibody; MGST3 (Microsomal Glutathione S-transferase 3; Microsomal GST-3; Microsomal GST-III) (HRP); anti-MGST3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MGST3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-MGST3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human MGST3, aa1-152 (NP_004519.1).
• Immunogen Sequence: MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MGST3 expression in transfected 293T cell line by MGST3 polyclonal antibody. Lane 1: MGST3 transfected lysate (16.5kD). Lane 2: Non-transfected lysate)

Related Product Information for anti-MGST3 antibody

The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved the production of leukotrienes and prostaglandin E, important mediators of inflammation. MGST3 is an enzyme which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. This enzyme also demonstrates glutathione-dependent peroxidase activity towards lipid hydroperoxides.

Product Categories/Family for anti-MGST3 antibody

Antibodies; GST

NCBI and Uniprot Product Information

• NCBI GI #: 4758714
• NCBI GeneID: 4259
• NCBI Accession #: NP_004519.1
• NCBI GenBank Nucleotide #: NM_004528.2
• UniProt Accession #: O14880; Q6ICN4; B2R592
• Molecular Weight: 16,516 Da
• NCBI Official Full Name: microsomal glutathione S-transferase 3
• NCBI Official Synonym Full Names: microsomal glutathione S-transferase 3
• NCBI Official Symbol: MGST3
• NCBI Official Synonym Symbols: GST-III
• NCBI Protein Information: microsomal glutathione S-transferase 3; microsomal GST-3; microsomal GST-III; microsomal glutathione S-transferase III
• UniProt Protein Name: Microsomal glutathione S-transferase 3
• Protein Family: Microsomal glutathione S-transferase
• UniProt Gene Name: MGST3
• UniProt Synonym Gene Names: Microsomal GST-3
• UniProt Entry Name: MGST3_HUMAN

NCBI Description

This gene encodes a member of the MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) protein family. Members of this family are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes an enzyme which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. This enzyme also demonstrates glutathione-dependent peroxidase activity towards lipid hydroperoxides.[provided by RefSeq, May 2011]

Uniprot Description

MGST3: Also functions as a glutathione peroxidase. Belongs to the MAPEG family.

Protein type: Xenobiotic Metabolism - drug metabolism - cytochrome P450; Membrane protein, integral; Membrane protein, multi-pass; Other Amino Acids Metabolism - glutathione; Transferase; Xenobiotic Metabolism - metabolism by cytochrome P450; EC 2.5.1.18

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: endoplasmic reticulum membrane; membrane; intracellular membrane-bound organelle; integral to membrane; nuclear envelope

Molecular Function: peroxidase activity; glutathione transferase activity; glutathione peroxidase activity

Biological Process: xenobiotic metabolic process; lipid metabolic process; signal transduction