Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MGST3 expression in transfected 293T cell line by MGST3 polyclonal antibody. Lane 1: MGST3 transfected lysate (16.5kD). Lane 2: Non-transfected lysate)

Rabbit anti-Human MGST3 Polyclonal Antibody | anti-MGST3 antibody

MGST3 (Microsomal Glutathione S-transferase 3, Microsomal GST-3, Microsomal GST-III) APC

Gene Names
MGST3; GST-III
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MGST3; Polyclonal Antibody; MGST3 (Microsomal Glutathione S-transferase 3; Microsomal GST-3; Microsomal GST-III) APC; anti-MGST3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MGST3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-MGST3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MGST3, aa1-152 (NP_004519.1).
Immunogen Sequence
MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MGST3 expression in transfected 293T cell line by MGST3 polyclonal antibody. Lane 1: MGST3 transfected lysate (16.5kD). Lane 2: Non-transfected lysate)

Western Blot (WB) (Western Blot analysis of MGST3 expression in transfected 293T cell line by MGST3 polyclonal antibody. Lane 1: MGST3 transfected lysate (16.5kD). Lane 2: Non-transfected lysate)
Related Product Information for anti-MGST3 antibody
The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved the production of leukotrienes and prostaglandin E, important mediators of inflammation. MGST3 is an enzyme which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. This enzyme also demonstrates glutathione-dependent peroxidase activity towards lipid hydroperoxides.
Product Categories/Family for anti-MGST3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,516 Da
NCBI Official Full Name
microsomal glutathione S-transferase 3
NCBI Official Synonym Full Names
microsomal glutathione S-transferase 3
NCBI Official Symbol
MGST3
NCBI Official Synonym Symbols
GST-III
NCBI Protein Information
microsomal glutathione S-transferase 3; microsomal GST-3; microsomal GST-III; microsomal glutathione S-transferase III
UniProt Protein Name
Microsomal glutathione S-transferase 3
UniProt Gene Name
MGST3
UniProt Synonym Gene Names
Microsomal GST-3
UniProt Entry Name
MGST3_HUMAN

NCBI Description

This gene encodes a member of the MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) protein family. Members of this family are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes an enzyme which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. This enzyme also demonstrates glutathione-dependent peroxidase activity towards lipid hydroperoxides.[provided by RefSeq, May 2011]

Uniprot Description

MGST3: Also functions as a glutathione peroxidase. Belongs to the MAPEG family.

Protein type: Xenobiotic Metabolism - drug metabolism - cytochrome P450; Membrane protein, integral; Membrane protein, multi-pass; Other Amino Acids Metabolism - glutathione; Transferase; Xenobiotic Metabolism - metabolism by cytochrome P450; EC 2.5.1.18

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: endoplasmic reticulum membrane; membrane; intracellular membrane-bound organelle; integral to membrane; nuclear envelope

Molecular Function: peroxidase activity; glutathione transferase activity; glutathione peroxidase activity

Biological Process: xenobiotic metabolic process; lipid metabolic process; signal transduction

Research Articles on MGST3

Similar Products

Product Notes

The MGST3 mgst3 (Catalog #AAA6385424) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MGST3 (Microsomal Glutathione S-transferase 3, Microsomal GST-3, Microsomal GST-III) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MGST3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MGST3 mgst3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MGST3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.