Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- MGST1 Picoband antibody, MBS178081, Western blottingAll lanes: Anti MGST1 (MBS178081) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 17KDObserved bind size: 17KD)

MGST1 Polyclonal Antibody | anti-MGST1 antibody

Anti-MGST1 Antibody

Gene Names
MGST1; MGST; GST12; MGST-I
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
MGST1; Polyclonal Antibody; Anti-MGST1 Antibody; Microsomal glutathione S-transferase 1; Glutathione S transferase 12; GST12; MGST 1; MGST; MGST1_HUMAN; Microsomal GST 1; Microsomal GST-1; Microsomal GST-I; microsomal glutathione S-transferase 1; anti-MGST1 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
155
Applicable Applications for anti-MGST1 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human MGST1 (42-75aa KVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- MGST1 Picoband antibody, MBS178081, Western blottingAll lanes: Anti MGST1 (MBS178081) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 17KDObserved bind size: 17KD)

Western Blot (WB) (Anti- MGST1 Picoband antibody, MBS178081, Western blottingAll lanes: Anti MGST1 (MBS178081) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 17KDObserved bind size: 17KD)
Related Product Information for anti-MGST1 antibody
Description: Rabbit IgG polyclonal antibody for Microsomal glutathione S-transferase 1(MGST1) detection. Tested with WB in Human;Mouse;Rat.

Background: Microsomal glutathione S-transferase 1 is an enzyme that in humans is encoded by the MGST1 gene. The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Several transcript variants, some non-protein coding and some protein coding, have been found for this gene.
References
1. Lee SH, DeJong J (1999). "Microsomal GST-I: genomic organization, expression, and alternative splicing of the human gene.". Biochim. Biophys. Acta 1446 (3): 389-96. 2. "Entrez Gene: MGST1 microsomal glutathione S-transferase 1".

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9,984 Da
NCBI Official Full Name
microsomal glutathione S-transferase 1 isoform a
NCBI Official Synonym Full Names
microsomal glutathione S-transferase 1
NCBI Official Symbol
MGST1
NCBI Official Synonym Symbols
MGST; GST12; MGST-I
NCBI Protein Information
microsomal glutathione S-transferase 1
UniProt Protein Name
Microsomal glutathione S-transferase 1
UniProt Gene Name
MGST1
UniProt Synonym Gene Names
GST12; MGST; Microsomal GST-1
UniProt Entry Name
MGST1_HUMAN

NCBI Description

The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Several transcript variants, some non-protein coding and some protein coding, have been found for this gene. [provided by RefSeq, May 2012]

Uniprot Description

MGST1: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a wide substrate specificity. Belongs to the MAPEG family.

Protein type: Transferase; Membrane protein, multi-pass; EC 2.5.1.18; Xenobiotic Metabolism - metabolism by cytochrome P450; Mitochondrial; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Membrane protein, integral; Other Amino Acids Metabolism - glutathione

Chromosomal Location of Human Ortholog: 12p12.3-p12.1

Cellular Component: apical part of cell; endoplasmic reticulum; endoplasmic reticulum membrane; integral to membrane; mitochondrial inner membrane; mitochondrial outer membrane; mitochondrion; nucleus; peroxisomal membrane

Molecular Function: glutathione binding; glutathione peroxidase activity; glutathione transferase activity; protein binding; protein homodimerization activity

Biological Process: glutathione metabolic process; Leydig cell differentiation; response to drug; response to lipopolysaccharide; response to organic nitrogen; xenobiotic metabolic process

Research Articles on MGST1

Similar Products

Product Notes

The MGST1 mgst1 (Catalog #AAA178081) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-MGST1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MGST1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the MGST1 mgst1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MGST1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.