Western Blot (WB)
(WB Suggested Anti-MGRN1 AntibodyPositive Control: Lane 1: 10ug MGRN1-GFP transfected HEK293T Lane 2: 10ug mut1MGRN1-GFP transfected HEK293T Lane 3: 10ug mut1MGRN2-GFP transfected HEK293T Lane 4: 10ug GFP transfected HEK293T Lane 5: 10ug IP for GFP using lysate from lane 1Primary Antibody Dilution : 1:1000Secondary Antibody : Goat anti rabbit-HRPSecondry Antibody Dilution : 1:50,000Submitted by: Teresa Gunn, McLaughin Research InstituteMGRN1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Rabbit MGRN1 Polyclonal Antibody | anti-MGRN1 antibody
MGRN1 antibody - middle region
Gene Names
MGRN1; RNF156
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MGRN1; Polyclonal Antibody; MGRN1 antibody - middle region; anti-MGRN1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTS
Sequence Length
576
Applicable Applications for anti-MGRN1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Goat: 79%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MGRN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MGRN1 AntibodyPositive Control: Lane 1: 10ug MGRN1-GFP transfected HEK293T Lane 2: 10ug mut1MGRN1-GFP transfected HEK293T Lane 3: 10ug mut1MGRN2-GFP transfected HEK293T Lane 4: 10ug GFP transfected HEK293T Lane 5: 10ug IP for GFP using lysate from lane 1Primary Antibody Dilution : 1:1000Secondary Antibody : Goat anti rabbit-HRPSecondry Antibody Dilution : 1:50,000Submitted by: Teresa Gunn, McLaughin Research InstituteMGRN1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Western Blot (WB)
(WB Suggested Anti-MGRN1 AntibodyPositive Control: Lane 1: 10ug MGRN1-GFP transfected HEK293T Lane 2: 10ug mut1MGRN1-GFP transfected HEK293T Lane 3: 10ug mut1MGRN2-GFP transfected HEK293T Lane 4: 10ug GFP transfected HEK293T Lane 5: 10ug IP for GFP using lysate from lane 1Primary Antibody Dilution : 1:1000Secondary Antibody : Goat anti rabbit-HRPSecondry Antibody Dilution : 1:50,000Submitted by: Teresa Gunn, McLaughin Research InstituteMGRN1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Western Blot (WB)
(WB Suggested Anti-MGRN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysateMGRN1 is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(WB Suggested Anti-MGRN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysateMGRN1 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-MGRN1 antibody
This is a rabbit polyclonal antibody against MGRN1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.[supplied by OMIM].
Target Description: Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.[supplied by OMIM].
Product Categories/Family for anti-MGRN1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase MGRN1 isoform 1
NCBI Official Synonym Full Names
mahogunin ring finger 1
NCBI Official Symbol
MGRN1
NCBI Official Synonym Symbols
RNF156
NCBI Protein Information
E3 ubiquitin-protein ligase MGRN1
UniProt Protein Name
E3 ubiquitin-protein ligase MGRN1
Protein Family
UniProt Gene Name
MGRN1
UniProt Synonym Gene Names
KIAA0544; RNF156
UniProt Entry Name
MGRN1_HUMAN
NCBI Description
Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.[supplied by OMIM, Apr 2004]
Research Articles on MGRN1
Similar Products
Product Notes
The MGRN1 mgrn1 (Catalog #AAA3206753) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MGRN1 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MGRN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MGRN1 mgrn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EIYGIENKNN QETKPSDDEN SDNSNECVVC LSDLRDTLIL PCRHLCLCTS. It is sometimes possible for the material contained within the vial of "MGRN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
