Rabbit MEX3A Polyclonal Antibody | anti-MEX3A antibody

MEX3A Antibody - N-terminal region

Cat. Num. AAA3218094

• Gene Names: MEX3A; RKHD4; MEX-3A; RNF162
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: MEX3A; Polyclonal Antibody; MEX3A Antibody - N-terminal region; anti-MEX3A antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GEEPVFMVTGRREDVATARREIISAAEHFSMIRASRNKSGAAFGVAPALP
• Sequence Length: 520

• Applicable Applications for anti-MEX3A antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MEX3A
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MEX3ASample Type: Fetal Brain lysatesAntibody Dilution: 1.0ug/ml)

Related Product Information for anti-MEX3A antibody

This is a rabbit polyclonal antibody against MEX3A. It was validated on Western Blot

Target Description: MEX3A is a RNA binding protein, may be involved in post-transcriptional regulatory mechanisms.

Product Categories/Family for anti-MEX3A antibody

Polyclonal; Transcription Factor; RNA Binding Proteins; DNA/RNA/Protein Interactions

NCBI and Uniprot Product Information

• NCBI GI #: 147902746
• NCBI GeneID: 92312
• NCBI Accession #: NP_001087194
• NCBI GenBank Nucleotide #: NM_001093725
• UniProt Accession #: A1L020
• Molecular Weight: 54kDa
• NCBI Official Full Name: RNA-binding protein MEX3A
• NCBI Official Synonym Full Names: mex-3 RNA binding family member A
• NCBI Official Symbol: MEX3A
• NCBI Official Synonym Symbols: RKHD4; MEX-3A; RNF162
• NCBI Protein Information: RNA-binding protein MEX3A
• UniProt Protein Name: RNA-binding protein MEX3A
• Protein Family: RNA-binding protein
• UniProt Gene Name: MEX3A
• UniProt Synonym Gene Names: RKHD4
• UniProt Entry Name: MEX3A_HUMAN

Uniprot Description

RKHD4: RNA binding protein, may be involved in post- transcriptional regulatory mechanisms.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: nucleus

Molecular Function: zinc ion binding