Western Blot (WB)
(WB Suggested Anti-METTL1 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Rabbit METTL1 Polyclonal Antibody | anti-METTL1 antibody
METTL1 antibody - middle region
Gene Names
METTL1; TRM8; TRMT8; C12orf1; YDL201w
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
METTL1; Polyclonal Antibody; METTL1 antibody - middle region; anti-METTL1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV
Sequence Length
301
Applicable Applications for anti-METTL1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 87%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human METTL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-METTL1 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-METTL1 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-METTL1 antibody
This is a rabbit polyclonal antibody against METTL1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: METTL1 contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation.This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X.
Target Description: METTL1 contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation.This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X.
Product Categories/Family for anti-METTL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
tRNA (guanine-N(7)-)-methyltransferase isoform a
NCBI Official Synonym Full Names
methyltransferase like 1
NCBI Official Symbol
METTL1
NCBI Official Synonym Symbols
TRM8; TRMT8; C12orf1; YDL201w
NCBI Protein Information
tRNA (guanine-N(7)-)-methyltransferase
UniProt Protein Name
tRNA (guanine-N(7)-)-methyltransferase
UniProt Gene Name
METTL1
UniProt Entry Name
TRMB_HUMAN
NCBI Description
This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X. [provided by RefSeq, Jul 2008]
Uniprot Description
METTL1: Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. Belongs to the methyltransferase superfamily. TrmB family.
Protein type: Methyltransferase; EC 2.1.1.33; RNA processing
Chromosomal Location of Human Ortholog: 12q13
Cellular Component: nucleoplasm; cytoplasm; nucleolus; nucleus
Molecular Function: protein binding; tRNA (guanine-N7-)-methyltransferase activity; tRNA binding
Biological Process: tRNA modification; tRNA methylation
Research Articles on METTL1
Similar Products
Product Notes
The METTL1 mettl1 (Catalog #AAA3209113) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The METTL1 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's METTL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the METTL1 mettl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KGQLTKMFFL FPDPHFKRTK HKWRIISPTL LAEYAYVLRV GGLVYTITDV. It is sometimes possible for the material contained within the vial of "METTL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
