Rabbit anti-Human MED28 Polyclonal Antibody | anti-MED28 antibody
MED28 Polyclonal Antibody
Gene Names
MED28; EG1; magicin; 1500003D12Rik
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
MED28; Polyclonal Antibody; MED28 Polyclonal Antibody; 1500003D12Rik; EG1; magicin; anti-MED28 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT
Sequence Length
178
Applicable Applications for anti-MED28 antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human MED28
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Membrane, Nucleus, Peripheral membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Product Categories/Family for anti-MED28 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19kDa
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 28
NCBI Official Synonym Full Names
mediator complex subunit 28
NCBI Official Symbol
MED28
NCBI Official Synonym Symbols
EG1; magicin; 1500003D12Rik
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 28
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 28
Protein Family
UniProt Gene Name
MED28
UniProt Synonym Gene Names
EG1; Magicin
Uniprot Description
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May be part of a complex containing NF2/merlin that participates in cellular signaling to the actin cytoskeleton downstream of tyrosine kinase signaling pathways.
Research Articles on MED28
Similar Products
Product Notes
The MED28 med28 (Catalog #AAA9135503) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MED28 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MED28 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the MED28 med28 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAPLGGMFS GQPPGPPQAP PGLPGQASLL QAAPGAPRPS SSTLVDELES SFEACFASLV SQDYVNGTDQ EEIRTGVDQC IQKFLDIARQ TECFFLQKRL QLSVQKPEQV IKEDVSELRN ELQRKDALVQ KHLTKLRHWQ QVLEDINVQH KKPADIPQGS LAYLEQASAN IPAPLKPT. It is sometimes possible for the material contained within the vial of "MED28, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
