Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MDK AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole Cell)

Rabbit MDK Polyclonal Antibody | anti-MDK antibody

MDK antibody - C-terminal region

Gene Names
MDK; MK; ARAP; NEGF2
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MDK; Polyclonal Antibody; MDK antibody - C-terminal region; anti-MDK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Sequence Length
143
Applicable Applications for anti-MDK antibody
Western Blot (WB)
Homology
Cow: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MDK AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole Cell)

Western Blot (WB) (WB Suggested Anti-MDK AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole Cell)
Related Product Information for anti-MDK antibody
This is a rabbit polyclonal antibody against MDK. It was validated on Western Blot

Target Description: Midkine is a retinoic acid-responsive, heparin-binding growth factor expressed in various cell types during embryogenesis. It promotes angiogenesis, cell growth, and cell migration. Midkine is also expressed in several carcinomas, suggesting that it may play a role in tumorigenesis, perhaps through its effects on angiogenesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
midkine isoform a
NCBI Official Synonym Full Names
midkine
NCBI Official Symbol
MDK
NCBI Official Synonym Symbols
MK; ARAP; NEGF2
NCBI Protein Information
midkine
UniProt Protein Name
Midkine
Protein Family
UniProt Gene Name
MDK
UniProt Synonym Gene Names
MK1; NEGF2; MK; ARAP
UniProt Entry Name
MK_HUMAN

NCBI Description

This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012]

Uniprot Description

MDK: Developmentally regulated, secreted growth factor homologous to pleiotrophin (PTN), which has heparin binding activity. Binds anaplastic lymphoma kinase (ALK) which induces ALK activation and subsequent phosphorylation of the insulin receptor substrate (IRS1), followed by the activation of mitogen-activated protein kinase (MAPK) and PI3-kinase, and the induction of cell proliferation. Involved in neointima formation after arterial injury, possibly by mediating leukocyte recruitment. Also involved in early fetal adrenal gland development. Belongs to the pleiotrophin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: cell projection; cytoplasm; extracellular region

Molecular Function: heparin binding; growth factor activity

Biological Process: response to drug; nervous system development; cell migration; Notch signaling pathway; dentate gyrus development; behavioral fear response; cerebellar granular layer development; short-term memory; adrenal gland development; positive regulation of transcription, DNA-dependent; response to glucocorticoid stimulus; signal transduction; positive regulation of cell division; response to wounding; cerebral cortex development; negative regulation of neuron apoptosis; cell differentiation; defecation; regulation of behavior

Research Articles on MDK

Similar Products

Product Notes

The MDK mdk (Catalog #AAA3216019) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MDK antibody - C-terminal region reacts with Cow, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MDK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MDK mdk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CDGGTGTKVR QGTLKKARYN AQCQETIRVT KPCTPKTKAK AKAKKGKGKD. It is sometimes possible for the material contained within the vial of "MDK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.