Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MDH2 antibody - C-terminal region validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.)

Rabbit MDH2 Polyclonal Antibody | anti-MDH2 antibody

MDH2 antibody - C-terminal region

Gene Names
MDH2; MDH; MOR1; M-MDH; EIEE51; MGC:3559
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
MDH2; Polyclonal Antibody; MDH2 antibody - C-terminal region; anti-MDH2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK
Sequence Length
338
Applicable Applications for anti-MDH2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MDH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(MDH2 antibody - C-terminal region validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.)

Western Blot (WB) (MDH2 antibody - C-terminal region validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.)

Western Blot (WB)

(WB Suggested Anti-MDH2 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-MDH2 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-MDH2 antibody
This is a rabbit polyclonal antibody against MDH2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH2 is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-MDH2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
malate dehydrogenase, mitochondrial isoform 1
NCBI Official Synonym Full Names
malate dehydrogenase 2
NCBI Official Symbol
MDH2
NCBI Official Synonym Symbols
MDH; MOR1; M-MDH; EIEE51; MGC:3559
NCBI Protein Information
malate dehydrogenase, mitochondrial
UniProt Protein Name
Malate dehydrogenase, mitochondrial
Protein Family
UniProt Gene Name
MDH2
UniProt Entry Name
MDHM_HUMAN

NCBI Description

Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]

Uniprot Description

MDH2: mitochondrial malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. May play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.

Protein type: Mitochondrial; Carbohydrate Metabolism - pyruvate; Carbohydrate Metabolism - glyoxylate and dicarboxylate; EC 1.1.1.37; Carbohydrate Metabolism - citrate (TCA) cycle; Oxidoreductase

Chromosomal Location of Human Ortholog: 7cen-q22

Cellular Component: nucleoplasm; mitochondrion; mitochondrial matrix; mitochondrial inner membrane; plasma membrane; nucleus

Molecular Function: protein self-association; L-malate dehydrogenase activity; malate dehydrogenase (NADP+) activity

Biological Process: cellular metabolic process; malate metabolic process; oxaloacetate metabolic process; NADH metabolic process; tricarboxylic acid cycle; carbohydrate metabolic process; glucose metabolic process; cellular carbohydrate metabolic process; pathogenesis; internal protein amino acid acetylation; gluconeogenesis

Research Articles on MDH2

Similar Products

Product Notes

The MDH2 mdh2 (Catalog #AAA3208960) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MDH2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MDH2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MDH2 mdh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TYFSTPLLLG KKGIEKNLGI GKVSSFEEKM ISDAIPELKA SIKKGEDFVK. It is sometimes possible for the material contained within the vial of "MDH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.