Mouse anti-Human AKAP8 Monoclonal Antibody | anti-AKAP8 antibody

AKAP8 (A-kinase Anchor Protein 8, AKAP-8, A-kinase Anchor Protein 95kD, AKAP 95, AKAP95, DKFZp586B1222) (Biotin)

• Gene Names: AKAP8; AKAP-8; AKAP95; AKAP 95; AKAP-95
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AKAP8; Monoclonal Antibody; AKAP8 (A-kinase Anchor Protein 8; AKAP-8; A-kinase Anchor Protein 95kD; AKAP 95; AKAP95; DKFZp586B1222) (Biotin); anti-AKAP8 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3D4
• Specificity: Recognizes human AKAP8.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-AKAP8 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa551-662 from AKAP8 (NP_005849) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAES
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(AKAP8 monoclonal antibody (Western Blot analysis of AKAP8 expression in HeLa NE)

IP (Immunoprecipitation)

(Immunoprecipitation of AKAP8 transfected lysate using AKAP8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AKAP8 monoclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to AKAP8 on HeLa cell. [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to AKAP8 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of AKAP8 expression in transfected 293T cell line by AKAP8 monoclonal antibody Lane 1: AKAP8 transfected lysate (76.2kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (38.43kD).)

Product Categories/Family for anti-AKAP8 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 5031579
• NCBI GeneID: 10270
• NCBI Accession #: NP_005849
• NCBI GenBank Nucleotide #: NM_005858
• UniProt Accession #: O43823
• Molecular Weight: 76kDa
• NCBI Official Full Name: A-kinase anchor protein 8
• NCBI Official Synonym Full Names: A-kinase anchoring protein 8
• NCBI Official Symbol: AKAP8
• NCBI Official Synonym Symbols: AKAP-8; AKAP95; AKAP 95; AKAP-95
• NCBI Protein Information: A-kinase anchor protein 8
• UniProt Protein Name: A-kinase anchor protein 8
• UniProt Gene Name: AKAP8
• UniProt Synonym Gene Names: AKAP95; AKAP-8; AKAP 95
• UniProt Entry Name: AKAP8_HUMAN