Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MCM5 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Rabbit MCM5 Polyclonal Antibody | anti-MCM5 antibody

MCM5 antibody - N-terminal region

Gene Names
MCM5; CDC46; MGORS8; P1-CDC46
Reactivity
Cow, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
MCM5; Polyclonal Antibody; MCM5 antibody - N-terminal region; anti-MCM5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG
Sequence Length
734
Applicable Applications for anti-MCM5 antibody
Western Blot (WB)
Homology
Cow: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MCM5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MCM5 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-MCM5 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-MCM5 antibody
This is a rabbit polyclonal antibody against MCM5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by MCM5 is structurally very similar to the CDC46 protein from S. cerevisiae, a protein involved in the initiation of DNA replication. The encoded protein is a member of the MCM family of chromatin-binding proteins and can interact with at least two other members of this family. The encoded protein is upregulated in the transition from the G0 to G1/S phase of the cell cycle and may actively participate in cell cycle regulation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
DNA replication licensing factor MCM5
NCBI Official Synonym Full Names
minichromosome maintenance complex component 5
NCBI Official Symbol
MCM5
NCBI Official Synonym Symbols
CDC46; MGORS8; P1-CDC46
NCBI Protein Information
DNA replication licensing factor MCM5
UniProt Protein Name
DNA replication licensing factor MCM5
UniProt Gene Name
MCM5
UniProt Synonym Gene Names
CDC46
UniProt Entry Name
MCM5_HUMAN

NCBI Description

The protein encoded by this gene is structurally very similar to the CDC46 protein from S. cerevisiae, a protein involved in the initiation of DNA replication. The encoded protein is a member of the MCM family of chromatin-binding proteins and can interact with at least two other members of this family. The encoded protein is upregulated in the transition from the G0 to G1/S phase of the cell cycle and may actively participate in cell cycle regulation. [provided by RefSeq, Jul 2008]

Uniprot Description

MCM5: Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Interacts with MCMBP. Belongs to the MCM family.

Protein type: EC 3.6.4.12; Cell cycle regulation

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: nucleoplasm; MCM complex; membrane; nucleus

Molecular Function: protein binding; DNA helicase activity; DNA binding; ATP binding

Biological Process: DNA replication initiation; mitotic cell cycle; DNA strand elongation during DNA replication; DNA replication; DNA duplex unwinding; G1/S transition of mitotic cell cycle

Research Articles on MCM5

Similar Products

Product Notes

The MCM5 mcm5 (Catalog #AAA3203248) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MCM5 antibody - N-terminal region reacts with Cow, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MCM5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MCM5 mcm5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSGFDDPGIF YSDSFGGDAQ ADEGQARKSQ LQRRFKEFLR QYRVGTDRTG. It is sometimes possible for the material contained within the vial of "MCM5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.