Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MCAT expression in transfected 293T cell line by MCAT polyclonal antibody. Lane 1: MCAT transfected lysate (19.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human MCAT Polyclonal Antibody | anti-MCAT antibody

MCAT (MT, Malonyl-CoA-acyl Carrier Protein Transacylase, Mitochondrial, Mitochondrial Malonyl CoA:ACP Acyltransferase, Mitochondrial Malonyltransferase, [Acyl-carrier-protein] Malonyltransferase)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MCAT; Polyclonal Antibody; MCAT (MT; Malonyl-CoA-acyl Carrier Protein Transacylase; Mitochondrial; Mitochondrial Malonyl CoA:ACP Acyltransferase; Mitochondrial Malonyltransferase; [Acyl-carrier-protein] Malonyltransferase); Anti -MCAT (MT; anti-MCAT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MCAT.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGSTVSPEEFL
Applicable Applications for anti-MCAT antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human MCAT, aa1-180 (NP_055322.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MCAT expression in transfected 293T cell line by MCAT polyclonal antibody. Lane 1: MCAT transfected lysate (19.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MCAT expression in transfected 293T cell line by MCAT polyclonal antibody. Lane 1: MCAT transfected lysate (19.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MCAT antibody
The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex that is more like the type II prokaryotic and plastid complexes rather than the type I human cytosolic complex. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-MCAT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
malonyl-CoA-acyl carrier protein transacylase, mitochondrial
NCBI Official Synonym Full Names
malonyl CoA:ACP acyltransferase (mitochondrial)<
NCBI Official Symbol
MCAT
NCBI Protein Information
malonyl-CoA-acyl carrier protein transacylase, mitochondrial

Similar Products

Product Notes

The MCAT (Catalog #AAA646668) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MCAT (MT, Malonyl-CoA-acyl Carrier Protein Transacylase, Mitochondrial, Mitochondrial Malonyl CoA:ACP Acyltransferase, Mitochondrial Malonyltransferase, [Acyl-carrier-protein] Malonyltransferase) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MCAT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the MCAT for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSVRVARVAW VRGLGASYRR GASSFPVPPP GAQGVAELLR DATGAEEEAP WAATERRMPG QCSVLLFPGQ GSQVVGMGRG LLNYPRVREL YAAARRVLGY DLLELSLHGP QETLDRTVHC QPAIFVASLA AVEKLHHLQP SVIENCVAAA GFSVGEFAAL VFAGAMEFAE GSTVSPEEFL. It is sometimes possible for the material contained within the vial of "MCAT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.