Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MAPK9Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MAPK9 Polyclonal Antibody | anti-MAPK9 antibody

MAPK9 Antibody - C-terminal region

Gene Names
MAPK9; JNK2; SAPK; p54a; JNK2A; JNK2B; PRKM9; JNK-55; SAPK1a; JNK2BETA; p54aSAPK; JNK2ALPHA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MAPK9; Polyclonal Antibody; MAPK9 Antibody - C-terminal region; anti-MAPK9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASD
Sequence Length
167
Applicable Applications for anti-MAPK9 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MAPK9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MAPK9Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MAPK9Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MAPK9 antibody
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. This gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.
Product Categories/Family for anti-MAPK9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48 kDa
NCBI Official Full Name
mitogen-activated protein kinase 9 isoform JNK2 gamma
NCBI Official Synonym Full Names
mitogen-activated protein kinase 9
NCBI Official Symbol
MAPK9
NCBI Official Synonym Symbols
JNK2; SAPK; p54a; JNK2A; JNK2B; PRKM9; JNK-55; SAPK1a; JNK2BETA; p54aSAPK; JNK2ALPHA
NCBI Protein Information
mitogen-activated protein kinase 9
UniProt Protein Name
Mitogen-activated protein kinase 9
UniProt Gene Name
MAPK9
UniProt Synonym Gene Names
JNK2; PRKM9; SAPK1A; MAP kinase 9; MAPK 9; SAPK1a
UniProt Entry Name
MK09_HUMAN

NCBI Description

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. This gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Sep 2008]

Uniprot Description

JNK2: a protein kinase of the MAPK family that is potently activated by a variety of environmental stresses including UV radiation. Phosphorylates specific transcription factors such as c-Jun and ATF2, mediating immediate-early gene expression. Closely related to JNK1. Both are involved in UV radiation induced apoptosis. Blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. JNK1 and JNK2 are required for polarized differentiation of T-helper cells into Th1 cells in the mouse. Four alternatively-spliced isoforms have been described.

Protein type: Kinase, protein; Protein kinase, CMGC; EC 2.7.11.24; Protein kinase, Ser/Thr (non-receptor); CMGC group; MAPK family; MAPK/JNK subfamily; JNK subfamily

Chromosomal Location of Human Ortholog: 5q35

Cellular Component: nucleoplasm; mitochondrion; cytosol

Molecular Function: protein binding; caspase activator activity; mitogen-activated protein kinase kinase kinase binding; JUN kinase activity; transcription factor binding; ATP binding

Biological Process: central nervous system development; positive regulation of nitric oxide biosynthetic process; regulation of protein ubiquitination; positive regulation of transcription, DNA-dependent; response to toxin; rhythmic process; stress-activated MAPK cascade; toll-like receptor 3 signaling pathway; protein amino acid phosphorylation; regulation of JNK cascade; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; regulation of transcription factor activity; JNK cascade; response to stress; protein targeting to mitochondrion; toll-like receptor 4 signaling pathway; neurite development; positive regulation of prostaglandin biosynthetic process; caspase activation; response to drug; release of cytochrome c from mitochondria; MyD88-independent toll-like receptor signaling pathway; regulation of circadian rhythm; positive regulation of chemokine production; JUN phosphorylation; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; response to cadmium ion; response to mechanical stimulus; positive regulation of prostaglandin secretion; toll-like receptor signaling pathway; innate immune response; toll-like receptor 9 signaling pathway; positive regulation of protein amino acid phosphorylation; response to amine stimulus; positive regulation of nitric-oxide synthase biosynthetic process

Research Articles on MAPK9

Similar Products

Product Notes

The MAPK9 mapk9 (Catalog #AAA3220376) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPK9 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPK9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAPK9 mapk9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EVMDWEERSK NGVVKDQPSD AAVSSNATPS QSSSINDISS MSTEQTLASD. It is sometimes possible for the material contained within the vial of "MAPK9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.