Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- JNK2 antibody, Western blottingAll lanes: Anti JNK2 at 0.5ug/ml)

anti-Human JNK2 Polyclonal Antibody | anti-JNK2 antibody

Anti-JNK2 Antibody

Gene Names
MAPK9; JNK2; SAPK; p54a; JNK2A; JNK2B; PRKM9; JNK-55; SAPK1a; JNK2BETA; p54aSAPK; JNK2ALPHA
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
JNK2; Polyclonal Antibody; Anti-JNK2 Antibody; Mitogen-activated protein kinase 9; c Jun kinase 2; C Jun N terminal kinase 2; c-Jun N-terminal kinase 2; JNK 55; JNK-55; JNK2 alpha; JNK2 beta; JNK2A; JNK2alpha; JNK2B; JNK2BETA; Jun kinase; MAP kinase 9; MAPK 9; Mapk9; Mitogen activated protein kinase 9; MK09_HUMAN; P54a; p54aSAPK; PRKM9; SAPK alpha; SAPK; SAPK1a; Stress activated protein kinase 1a; Stress-activated protein kinase JNK2; mitogen-activated protein kinase 9; anti-JNK2 antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
242
Applicable Applications for anti-JNK2 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human JNK2 (257-288aa RNYVENRPKYPGIKFEELFPDWIFPSESERDK), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- JNK2 antibody, Western blottingAll lanes: Anti JNK2 at 0.5ug/ml)

Western Blot (WB) (Anti- JNK2 antibody, Western blottingAll lanes: Anti JNK2 at 0.5ug/ml)
Related Product Information for anti-JNK2 antibody
Description: Rabbit IgG polyclonal antibody for Mitogen-activated protein kinase 9(MAPK9) detection. Tested with WB in Human.

Background: JNK2 is also known as MAPK9. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. Also, this gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.
References
1. Raciti M; Lotti LV; Valia S; Pulcinelli FM; Di Renzo L. "JNK2 is activated during ER stress and promotes cell survival". Cell Death Dis, 2012 Nov 22. 2. Wang P; Xiong Y; Ma C; Shi T; Ma D. "Molecular cloning and characterization of novel human JNK2 (MAPK9) transcript variants that show different stimulation activities on AP-1". BMB Rep, 2010 Nov.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,334 Da
NCBI Official Full Name
mitogen-activated protein kinase 9 isoform JNK2 gamma
NCBI Official Synonym Full Names
mitogen-activated protein kinase 9
NCBI Official Symbol
MAPK9
NCBI Official Synonym Symbols
JNK2; SAPK; p54a; JNK2A; JNK2B; PRKM9; JNK-55; SAPK1a; JNK2BETA; p54aSAPK; JNK2ALPHA
NCBI Protein Information
mitogen-activated protein kinase 9
UniProt Protein Name
Mitogen-activated protein kinase 9
UniProt Gene Name
MAPK9
UniProt Synonym Gene Names
JNK2; PRKM9; SAPK1A; MAP kinase 9; MAPK 9; SAPK1a
UniProt Entry Name
MK09_HUMAN

NCBI Description

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. This gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Sep 2008]

Uniprot Description

JNK2: a protein kinase of the MAPK family that is potently activated by a variety of environmental stresses including UV radiation. Phosphorylates specific transcription factors such as c-Jun and ATF2, mediating immediate-early gene expression. Closely related to JNK1. Both are involved in UV radiation induced apoptosis. Blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. JNK1 and JNK2 are required for polarized differentiation of T-helper cells into Th1 cells in the mouse. Four alternatively-spliced isoforms have been described.

Protein type: Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.24; Protein kinase, CMGC; CMGC group; MAPK family; MAPK/JNK subfamily; JNK subfamily

Chromosomal Location of Human Ortholog: 5q35

Cellular Component: cytosol; mitochondrion; nucleoplasm

Molecular Function: ATP binding; caspase activator activity; JUN kinase activity; mitogen-activated protein kinase kinase kinase binding; protein binding; transcription factor binding

Biological Process: caspase activation; central nervous system development; JNK cascade; JUN phosphorylation; neurite development; positive regulation of chemokine production; positive regulation of nitric oxide biosynthetic process; positive regulation of nitric-oxide synthase biosynthetic process; positive regulation of prostaglandin biosynthetic process; positive regulation of prostaglandin secretion; positive regulation of protein amino acid phosphorylation; positive regulation of transcription, DNA-dependent; protein amino acid phosphorylation; protein targeting to mitochondrion; regulation of circadian rhythm; regulation of JNK cascade; regulation of protein ubiquitination; regulation of transcription factor activity; release of cytochrome c from mitochondria; response to amine stimulus; response to cadmium ion; response to drug; response to mechanical stimulus; response to stress; response to toxin; rhythmic process

Research Articles on JNK2

Similar Products

Product Notes

The JNK2 mapk9 (Catalog #AAA178157) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-JNK2 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's JNK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the JNK2 mapk9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "JNK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.