Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MAPK8IP2Sample Tissue: Human Leiomyosarcoma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MAPK8IP2 Polyclonal Antibody | anti-MAPK8IP2 antibody

MAPK8IP2 Antibody - middle region

Gene Names
MAPK8IP2; IB2; IB-2; JIP2; PRKM8IPL
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MAPK8IP2; Polyclonal Antibody; MAPK8IP2 Antibody - middle region; anti-MAPK8IP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SEPEPPREPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADSPWLLSNL
Sequence Length
824
Applicable Applications for anti-MAPK8IP2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MAPK8IP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MAPK8IP2Sample Tissue: Human Leiomyosarcoma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MAPK8IP2Sample Tissue: Human Leiomyosarcoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MAPK8IP2 antibody
The protein encoded by this gene is closely related to MAPK8IP1/IB1/JIP-1, a scaffold protein that is involved in the c-Jun amino-terminal kinase signaling pathway. This protein is expressed in brain and pancreatic cells. It has been shown to interact with, and regulate the activity of MAPK8/JNK1, and MAP2K7/MKK7 kinases. This protein thus is thought to function as a regulator of signal transduction by protein kinase cascade in brain and pancreatic beta-cells.
Product Categories/Family for anti-MAPK8IP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90 kDa
NCBI Official Full Name
C-Jun-amino-terminal kinase-interacting protein 2
NCBI Official Synonym Full Names
mitogen-activated protein kinase 8 interacting protein 2
NCBI Official Symbol
MAPK8IP2
NCBI Official Synonym Symbols
IB2; IB-2; JIP2; PRKM8IPL
NCBI Protein Information
C-Jun-amino-terminal kinase-interacting protein 2
UniProt Protein Name
C-Jun-amino-terminal kinase-interacting protein 2
UniProt Gene Name
MAPK8IP2
UniProt Synonym Gene Names
IB2; JIP2; PRKM8IPL; JIP-2; JNK-interacting protein 2; IB-2
UniProt Entry Name
JIP2_HUMAN

NCBI Description

This gene encodes a scaffold protein that is thought to be involved in the regulation of the c-Jun amino-terminal kinase signaling pathway. This protein has been shown to interact with and regulate the activity of MAPK8/JNK1 and MAP2K7/MKK7 kinases. [provided by RefSeq, Jun 2017]

Uniprot Description

MAPK8IP2: The JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. JIP2 inhibits IL1 beta-induced apoptosis in insulin-secreting cells. May function as a regulator of vesicle transport, through interactions with the JNK-signaling components and motor proteins. Belongs to the JIP scaffold family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, regulatory subunit; Activator

Chromosomal Location of Human Ortholog: 22q13.33

Cellular Component: protein complex; cell soma; cytoplasm

Molecular Function: MAP-kinase scaffold activity; protein binding; kinesin binding; beta-amyloid binding; protein complex binding; structural molecule activity; protein kinase binding; protein kinase activator activity

Biological Process: nonassociative learning; regulation of synaptic transmission, glutamatergic; behavioral fear response; dendrite morphogenesis; MAPKKK cascade; mating behavior; signal complex assembly; social behavior; regulation of JNK cascade; positive regulation of stress-activated MAPK cascade; positive regulation of protein kinase activity; JNK cascade; regulation of receptor activity; regulation of excitatory postsynaptic membrane potential

Research Articles on MAPK8IP2

Similar Products

Product Notes

The MAPK8IP2 mapk8ip2 (Catalog #AAA3222736) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPK8IP2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPK8IP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAPK8IP2 mapk8ip2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SEPEPPREPP RRPAFLPVGP DDTNSEYESG SESEPDLSED ADSPWLLSNL. It is sometimes possible for the material contained within the vial of "MAPK8IP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.