Rabbit anti-Human MAPK13 Polyclonal Antibody | anti-MAPK13 antibody

MAPK13 (Mitogen-activated Protein Kinase 13, MAPK 13, MAP Kinase 13, PRKM13, Mitogen-activated Protein Kinase p38 delta, MAP Kinase p38 delta, p38delta, Stress-activated Protein Kinase 4, SAPK4, MGC99536) (PE)

Cat. Num. AAA6384894

• Gene Names: MAPK13; SAPK4; PRKM13; MAPK 13; MAPK-13; p38delta
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MAPK13; Polyclonal Antibody; MAPK13 (Mitogen-activated Protein Kinase 13; MAPK 13; MAP Kinase 13; PRKM13; Mitogen-activated Protein Kinase p38 delta; MAP Kinase p38 delta; p38delta; Stress-activated Protein Kinase 4; SAPK4; MGC99536) (PE); anti-MAPK13 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MAPK13.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-MAPK13 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human MAPK13, aa1-538 (NP_002745.1).
• Immunogen Sequence: MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MAPK13 expression in transfected 293T cell line by MAPK13 polyclonal antibody. Lane 1: MAPK13 transfected lysate (42.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK13 and MAPKAPK3 HeLa cells were stained with MAPK13 rabbit purified polyclonal 1:1200 and MAPKAPK3 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-MAPK13 antibody

MAP kinase p38 delta, a MAPK type protein kinase, is an environmental stress-and inflammatory cytokine-induced kinase that is associated with the regulation of gene expression and cell proliferation. p38delta is phosphorylated by MEK3/MAP2K3 or MKK6/MAP2K6. Activated p38delta has been shown to phosphorylate ATF2, eEF2K, MBP and PHAS-1.

Product Categories/Family for anti-MAPK13 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4506085
• NCBI GeneID: 5603
• NCBI Accession #: NP_002745.1
• NCBI GenBank Nucleotide #: NM_002754
• UniProt Accession #: O15264; O14739; O15124; Q5U4A5; Q6FI46; Q9UNU0
• Molecular Weight: 28,779 Da
• NCBI Official Full Name: mitogen-activated protein kinase 13
• NCBI Official Synonym Full Names: mitogen-activated protein kinase 13
• NCBI Official Symbol: MAPK13
• NCBI Official Synonym Symbols: SAPK4; PRKM13; MAPK 13; MAPK-13; p38delta
• NCBI Protein Information: mitogen-activated protein kinase 13; MAP kinase 13; MAP kinase p38 delta; mitogen-activated protein kinase p38 delta; stress-activated protein kinase 4
• UniProt Protein Name: Mitogen-activated protein kinase 13
• UniProt Gene Name: MAPK13
• UniProt Synonym Gene Names: PRKM13; SAPK4; MAP kinase 13; MAPK 13; MAP kinase p38 delta
• UniProt Entry Name: MK13_HUMAN

NCBI Description

This gene encodes a member of the mitogen-activated protein (MAP) kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The encoded protein is a p38 MAP kinase and is activated by proinflammatory cytokines and cellular stress. Substrates of the encoded protein include the transcription factor ATF2 and the microtubule dynamics regulator stathmin. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

P38D: a proline-directed ser/thr MAP kinase, and one of four p38 kinases that play important roles in cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have a few hundred substrates each. MAPK13 is one of the less studied p38 MAPK isoforms. Some of the targets are downstream kinases such as MAPKAPK2, which are activated through phosphorylation and further phosphorylate additional targets. Plays a role in the regulation of protein translation by phosphorylating and inactivating EEF2K. Involved in cytoskeletal remodeling through phosphorylation of tau and STH. Mediates UV irradiation induced up-regulation of the gene expression of CXCL14. Plays an important role in the regulation of epidermal keratinocyte differentiation, apoptosis and skin tumor development. Phosphorylates the transcriptional activator Myb in response to stress which leads to rapid Myb degradation via a proteasome-dependent pathway. Phosphorylates and down-regulates PKD1 during regulation of insulin secretion in pancreatic beta cells. Expressed in testes, pancreas, small intestine, lung and kidney. Abundant in macrophages, also present in neutrophils, CD4+ T-cells, and endothelial cells. This description may include information from UniProtKB

Protein type: Protein kinase, CMGC; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.24; CMGC group; MAPK family; p38 subfamily; MAPK/p38 subfamily

Chromosomal Location of Human Ortholog: 6p21.31

Cellular Component: cytosol

Molecular Function: MAP kinase activity; protein serine/threonine kinase activity; protein binding; ATP binding

Biological Process: peptidyl-serine phosphorylation; regulation of transcription, DNA-dependent; nerve growth factor receptor signaling pathway; transcription, DNA-dependent; Ras protein signal transduction; MAPKKK cascade; response to stress; positive regulation of interleukin-6 production; vascular endothelial growth factor receptor signaling pathway; cell cycle; response to osmotic stress; positive regulation of inflammatory response