Rabbit anti-Human MAPK10 Polyclonal Antibody | anti-MAPK10 antibody

MAPK10 Antibody - C-terminal region

Cat. Num. AAA3222607

• Gene Names: MAPK10; JNK3; JNK3A; PRKM10; SAPK1b; p493F12; p54bSAPK
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: MAPK10; Polyclonal Antibody; MAPK10 Antibody - C-terminal region; anti-MAPK10 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAAV
• Sequence Length: 277

• Applicable Applications for anti-MAPK10 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MAPK10
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MAPK10Sample Tissue: Human Testicular Tumor lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-MAPK10 antibody

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as integration points for multiple biochemical signals and are involved in a wide variety of cellular processes, such as proliferation, differentiation, transcription regulation and development. This kinase is specifically expressed in a subset of neurons in the nervous system and is activated by threonine and tyrosine phosphorylation. Targeted deletion of this gene in mice suggests that it may have a role in stress-induced neuronal apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. A recent study provided evidence for translational readthrough in this gene and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon.

Product Categories/Family for anti-MAPK10 antibody

Polyclonal; Neurobiology; Transcription Regulation; Protein Kinases; Signaling Intermediate; Developmental Biology; Apoptosis; Meiosis/Mitosis/Cell Cycle

NCBI and Uniprot Product Information

• NCBI GI #: 4506081
• NCBI GeneID: 5602
• NCBI Accession #: NP_002744.1
• NCBI GenBank Nucleotide #: NM_002753.3
• UniProt Accession #: P53779
• Molecular Weight: 30 kDa
• NCBI Official Full Name: mitogen-activated protein kinase 10 isoform 2
• NCBI Official Synonym Full Names: mitogen-activated protein kinase 10
• NCBI Official Symbol: MAPK10
• NCBI Official Synonym Symbols: JNK3; JNK3A; PRKM10; SAPK1b; p493F12; p54bSAPK
• NCBI Protein Information: mitogen-activated protein kinase 10
• UniProt Protein Name: Mitogen-activated protein kinase 10
• UniProt Gene Name: MAPK10
• UniProt Synonym Gene Names: JNK3; JNK3A; PRKM10; SAPK1B; MAP kinase 10; MAPK 10; SAPK1b
• UniProt Entry Name: MK10_HUMAN

NCBI Description

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as integration points for multiple biochemical signals, and thus are involved in a wide variety of cellular processes, such as proliferation, differentiation, transcription regulation and development. This kinase is specifically expressed in a subset of neurons in the nervous system, and is activated by threonine and tyrosine phosphorylation. Targeted deletion of this gene in mice suggests that it may have a role in stress-induced neuronal apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. A recent study provided evidence for translational readthrough in this gene, and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon. [provided by RefSeq, Dec 2017]

Uniprot Description

JNK3: a protein kinase of the MAPK family that is potently activated by a variety of environmental stress and pro-inflammatory cytokines. Brain-selective JNK isoform. A pro-apoptotic protein and potential tumor suppressor. Phosphorylates a number of transcription factors including c-Jun, ATF2 and ELK1. Required for stress-induced neuronal apoptosis and the pathogenesis of glutamate excitotoxicity. CDK5 can phosphorylate and inhibit the activity of this kinase, which may be important in preventing neuronal apoptosis. Binds to at least four scaffolding proteins, JIP-1, -2, -3 and -4. Interacts with HDAC9. Expression lost in brain tumors. May function in neuronal cell death from injury and neurodegeneration, for which inhibitors are being developed. Two alternatively spliced transcript variants have been reported.

Protein type: Protein kinase, CMGC; Kinase, protein; EC 2.7.11.24; Protein kinase, Ser/Thr (non-receptor); CMGC group; MAPK family; MAPK/JNK subfamily; JNK subfamily

Chromosomal Location of Human Ortholog: 4q22.1-q23

Cellular Component: nucleoplasm; mitochondrion; cytoplasm; plasma membrane; cytosol

Molecular Function: MAP kinase kinase activity; protein binding; JUN kinase activity; ATP binding

Biological Process: response to light stimulus; activation of MAPK activity; MyD88-independent toll-like receptor signaling pathway; stress-activated MAPK cascade; rhythmic process; toll-like receptor 3 signaling pathway; regulation of circadian rhythm; signal transduction; protein amino acid phosphorylation; toll-like receptor 10 signaling pathway; toll-like receptor 2 signaling pathway; JUN phosphorylation; toll-like receptor 5 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; regulation of transcription factor activity; toll-like receptor signaling pathway; JNK cascade; innate immune response; toll-like receptor 9 signaling pathway; toll-like receptor 4 signaling pathway