Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RatTarget Name: MAPK1Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Rabbit MAPK1 Polyclonal Antibody | anti-MAPK1 antibody

MAPK1 antibody - middle region

Gene Names
MAPK1; ERK; p38; p40; p41; ERK2; ERT1; ERK-2; MAPK2; PRKM1; PRKM2; P42MAPK; p41mapk; p42-MAPK
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MAPK1; Polyclonal Antibody; MAPK1 antibody - middle region; anti-MAPK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPE
Sequence Length
360
Applicable Applications for anti-MAPK1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MAPK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RatTarget Name: MAPK1Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RatTarget Name: MAPK1Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-MAPK1 AntibodyPositive Control: Lane 1: 40ug HEK293 lysate Lane 2: 40ug U205 lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Goat anti-rabbit-HRPSecondry Antibody Dilution : 1:5000Submitted by: Jose Luis Rosa, Universitat de Barcelona )

Western Blot (WB) (WB Suggested Anti-MAPK1 AntibodyPositive Control: Lane 1: 40ug HEK293 lysate Lane 2: 40ug U205 lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Goat anti-rabbit-HRPSecondry Antibody Dilution : 1:5000Submitted by: Jose Luis Rosa, Universitat de Barcelona )

Western Blot (WB)

(WB Suggested Anti-MAPK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-MAPK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)
Related Product Information for anti-MAPK1 antibody
This is a rabbit polyclonal antibody against MAPK1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
mitogen-activated protein kinase 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase 1
NCBI Official Symbol
MAPK1
NCBI Official Synonym Symbols
ERK; p38; p40; p41; ERK2; ERT1; ERK-2; MAPK2; PRKM1; PRKM2; P42MAPK; p41mapk; p42-MAPK
NCBI Protein Information
mitogen-activated protein kinase 1
UniProt Protein Name
Mitogen-activated protein kinase 1
UniProt Gene Name
MAPK1
UniProt Synonym Gene Names
ERK2; PRKM1; PRKM2; MAP kinase 1; MAPK 1; ERK-2; p42-MAPK; MAP kinase 2; MAPK 2
UniProt Entry Name
MK01_HUMAN

NCBI Description

This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. [provided by RefSeq, Jan 2014]

Uniprot Description

ERK2: a serine/threonine kinase of the GMGC group that plays a critical role in the regulation of cell growth and differentiation. ERK1 (MAPK3) and ERK2 (MAPK1) play central roles in MAPK cascades and are activated by a wide variety of extracellular signals including growth and neurotrophic factors, cytokines, hormones and neurotransmitters. Depending on the cellular context, MAPK cascades mediate diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. MAPK cascades also plays a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. Activation of MAP kinases occurs through phosphorylation of threonine and tyrosine residues at the sequence T*EY* by upstream MAP kinase kinases, MEK1 and -2. Phosphorylation of both the threonine and tyrosine are required for activity. This phosphorylation causes dramatic conformational changes, which enable full activation and interaction of MAPK1/ERK2 with its substrates.

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Protein kinase, CMGC; EC 2.7.11.24; CMGC group; MAPK family; MAPK/ERK subfamily; ERK subfamily

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: dendrite cytoplasm; Golgi apparatus; protein complex; focal adhesion; mitochondrion; early endosome; perikaryon; pseudopodium; caveola; cytosol; nucleoplasm; microtubule cytoskeleton; cytoskeleton; axon; late endosome; cytoplasm; microtubule organizing center; nucleus

Molecular Function: RNA polymerase subunit kinase activity; MAP kinase activity; protein serine/threonine kinase activity; protein binding; DNA binding; phosphotyrosine binding; mitogen-activated protein kinase kinase kinase binding; transcription factor binding; ATP binding; phosphatase binding

Biological Process: nerve growth factor receptor signaling pathway; activation of MAPKK activity; viral reproduction; activation of MAPK activity; positive regulation of transcription, DNA-dependent; response to toxin; stress-activated MAPK cascade; toll-like receptor 3 signaling pathway; sensory perception of pain; protein amino acid phosphorylation; T cell receptor signaling pathway; toll-like receptor 5 signaling pathway; B cell receptor signaling pathway; regulation of transcription factor activity; small GTPase mediated signal transduction; toll-like receptor 4 signaling pathway; platelet activation; fibroblast growth factor receptor signaling pathway; transcription, DNA-dependent; toll-like receptor 2 signaling pathway; regulation of stress-activated MAPK cascade; nuclear translocation of MAPK; organ morphogenesis; response to estrogen stimulus; toll-like receptor 9 signaling pathway; regulation of cytoskeleton organization and biogenesis; axon guidance; positive regulation of translation; apoptosis; regulation of protein stability; chemotaxis; signal transduction; toll-like receptor 10 signaling pathway; synaptic transmission; response to exogenous dsRNA; positive regulation of cell proliferation; lipopolysaccharide-mediated signaling pathway; response to stress; epidermal growth factor receptor signaling pathway; MyD88-independent toll-like receptor signaling pathway; peptidyl-threonine phosphorylation; MAPKKK cascade; mammary gland epithelial cell proliferation; cell cycle; MyD88-dependent toll-like receptor signaling pathway; negative regulation of cell differentiation; peptidyl-serine phosphorylation; cytosine metabolic process; Ras protein signal transduction; insulin receptor signaling pathway; toll-like receptor signaling pathway; innate immune response; blood coagulation; vascular endothelial growth factor receptor signaling pathway; response to DNA damage stimulus; positive regulation of cell migration

Research Articles on MAPK1

Similar Products

Product Notes

The MAPK1 mapk1 (Catalog #AAA3214102) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPK1 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MAPK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAPK1 mapk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RDLKPSNLLL NTTCDLKICD FGLARVADPD HDHTGFLTEY VATRWYRAPE. It is sometimes possible for the material contained within the vial of "MAPK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.