Rabbit anti-Human MAP3K7 Polyclonal Antibody | anti-MAP3K7 antibody

MAP3K7 Antibody - C-terminal region

Cat. Num. AAA3219218

• Gene Names: MAP3K7; CSCF; FMD2; TAK1; MEKK7; TGF1a
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: MAP3K7; Polyclonal Antibody; MAP3K7 Antibody - C-terminal region; anti-MAP3K7 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDN
• Sequence Length: 579

• Applicable Applications for anti-MAP3K7 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MAP3K7
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MAP3K7Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

Related Product Information for anti-MAP3K7 antibody

This is a rabbit polyclonal antibody against MAP3K7. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase mediates the signaling transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcription regulation and apoptosis. In response to IL-1, this protein forms a kinase complex including TRAF6, MAP3K7P1/TAB1 and MAP3K7P2/TAB2; this complex is required for the activation of nuclear factor kappa B. This kinase can also activate MAPK8/JNK, MAP2K4/MKK4, and thus plays a role in the cell response to environmental stresses. Four alternatively spliced transcript variants encoding distinct isoforms have been reported.

Product Categories/Family for anti-MAP3K7 antibody

Polyclonal; Transcription Factor; Protein Kinases; Signal Transduction; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 4507361
• NCBI GeneID: 6885
• NCBI Accession #: NP_003179.1
• NCBI GenBank Nucleotide #: NM_003188.3
• UniProt Accession #: O43318
• Molecular Weight: 63kDa
• NCBI Official Full Name: mitogen-activated protein kinase kinase kinase 7 isoform A
• NCBI Official Synonym Full Names: mitogen-activated protein kinase kinase kinase 7
• NCBI Official Symbol: MAP3K7
• NCBI Official Synonym Symbols: CSCF; FMD2; TAK1; MEKK7; TGF1a
• NCBI Protein Information: mitogen-activated protein kinase kinase kinase 7
• UniProt Protein Name: Mitogen-activated protein kinase kinase kinase 7
• Protein Family: MAP3K7 C-terminal-like protein
• UniProt Gene Name: MAP3K7
• UniProt Synonym Gene Names: TAK1; TGF-beta-activated kinase 1
• UniProt Entry Name: M3K7_HUMAN

NCBI Description

The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase mediates the signaling transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcription regulation and apoptosis. In response to IL-1, this protein forms a kinase complex including TRAF6, MAP3K7P1/TAB1 and MAP3K7P2/TAB2; this complex is required for the activation of nuclear factor kappa B. This kinase can also activate MAPK8/JNK, MAP2K4/MKK4, and thus plays a role in the cell response to environmental stresses. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

TAK1: a protein kinase of the MLK family. Mediates signal transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcription regulation and apoptosis. In response to IL-1, forms a kinase complex including TRAF6, MAP3K7P1/TAB1 and MAP3K7P2/TAB2; this complex is required for the activation of nuclear factor kappa B. Also activates MAPK8/JNK, MAP2K4/MKK4, and thus plays a role in the cell response to environmental stresses. Four alternatively spliced isoforms have been reported. Three splice variant isoforms have been described.

Protein type: EC 2.7.11.25; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Protein kinase, TKL; TKL group; MLK family; TAK1 subfamily

Chromosomal Location of Human Ortholog: 6q15

Cellular Component: nucleoplasm; cytoplasm; plasma membrane; endosome membrane; IkappaB kinase complex; cytosol; nucleus

Molecular Function: MAP kinase kinase activity; protein serine/threonine kinase activity; protein binding; MAP kinase kinase kinase activity; magnesium ion binding; ATP binding; protein kinase activity

Biological Process: positive regulation of JNK activity; I-kappaB kinase/NF-kappaB cascade; activation of MAPKK activity; activation of MAPK activity; apoptosis; stress-activated MAPK cascade; positive regulation of T cell cytokine production; toll-like receptor 3 signaling pathway; T cell receptor signaling pathway; activation of NF-kappaB transcription factor; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; transforming growth factor beta receptor signaling pathway; JNK cascade; angiogenesis; toll-like receptor 4 signaling pathway; positive regulation of I-kappaB kinase/NF-kappaB cascade; transcription, DNA-dependent; MyD88-independent toll-like receptor signaling pathway; activation of NF-kappaB-inducing kinase; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; positive regulation of interleukin-2 production; toll-like receptor signaling pathway; innate immune response; positive regulation of T cell activation; toll-like receptor 9 signaling pathway; I-kappaB phosphorylation; neural tube formation