Rabbit anti-Human MAP2K3 Polyclonal Antibody | anti-MAP2K3 antibody

MAP2K3 (Dual Specificity Mitogen-activated Protein Kinase Kinase 3, Mitogen-activated Protein Kinase Kinase 3, MAP Kinase Kinase 3, MAPKK 3, MKK3, MAPK/ERK Kinase 3, MEK 3, MEK3, PRKMK3, Stress-activated Protein Kinase Kinase 2, SAPK Kinase 2, SAPKK2, SAP

Cat. Num. AAA6384798

• Gene Names: MAP2K3; MEK3; MKK3; MAPKK3; PRKMK3; SAPKK2; SAPKK-2
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MAP2K3; Polyclonal Antibody; MAP2K3 (Dual Specificity Mitogen-activated Protein Kinase Kinase 3; Mitogen-activated Protein Kinase Kinase 3; MAP Kinase Kinase 3; MAPKK 3; MKK3; MAPK/ERK Kinase 3; MEK 3; MEK3; PRKMK3; Stress-activated Protein Kinase Kinase 2; SAPK Kinase 2; SAPKK2; SAP; anti-MAP2K3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MAP2K3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 347

• Applicable Applications for anti-MAP2K3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human MAP2K3, aa1-347 (NP_659731.1).
• Immunogen Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MAP2K3 expression in transfected 293T cell line by MAP2K3 polyclonal antibody. Lane 1: MAP2K3 transfected lysate (39.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAP2K3 and MAP3K4 HeLa cells were stained with MAP2K3 rabbit purified polyclonal 1:1200 and MAP3K4 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-MAP2K3 antibody

MKK3 is a protein kinase that phosphorylates the p38 MAPK. Phosphorylation by MKK3 occurs on threonine and tyrosine residues and increases the activity of p38 to stimulate transcription factors ATF2 and Elk-1. MKK3, together with MKK6, serves as upstream regulators of p38 MAPK activation. A structural variant, MKK3b, has been identified that contains 29 more aa at its N-terminus.

Product Categories/Family for anti-MAP2K3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 21618349
• NCBI GeneID: 5606
• NCBI Accession #: NP_659731.1
• NCBI GenBank Nucleotide #: NM_145109.1
• UniProt Accession #: P46734
• NCBI Official Full Name: dual specificity mitogen-activated protein kinase kinase 3 isoform B
• NCBI Official Synonym Full Names: mitogen-activated protein kinase kinase 3
• NCBI Official Symbol: MAP2K3
• NCBI Official Synonym Symbols: MEK3; MKK3; MAPKK3; PRKMK3; SAPKK2; SAPKK-2
• NCBI Protein Information: dual specificity mitogen-activated protein kinase kinase 3
• UniProt Protein Name: Dual specificity mitogen-activated protein kinase kinase 3
• Protein Family: Dual specificity mitogen-activated protein kinase kinase
• UniProt Gene Name: MAP2K3
• UniProt Synonym Gene Names: MEK3; MKK3; PRKMK3; SKK2; MAP kinase kinase 3; MAPKK 3; MEK 3; SAPK kinase 2; SAPKK-2; SAPKK2
• UniProt Entry Name: MP2K3_HUMAN

NCBI Description

The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

MKK3: a dual-specificity protein kinase of the STE7 family. Activates p38 MAP kinase by phosphorylating a Thr and a Tyr residue in the activation loop. Is activated by cytokines and environmental stress in vivo. A deletion and two point mutants found in colon cancer cell lines. Three splice-variant isoforms have been described.

Protein type: Protein kinase, dual-specificity (non-receptor); Kinase, protein; Protein kinase, STE; EC 2.7.12.2; STE group; STE7 family

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: nucleoplasm; membrane; cytosol

Molecular Function: MAP kinase kinase activity; protein binding; protein-tyrosine kinase activity; protein kinase binding; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: peptidyl-tyrosine phosphorylation; activation of MAPK activity; positive regulation of transcription, DNA-dependent; MyD88-independent toll-like receptor signaling pathway; stress-activated MAPK cascade; pathogenesis; toll-like receptor 3 signaling pathway; signal transduction; toll-like receptor 2 signaling pathway; toll-like receptor 10 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; toll-like receptor 5 signaling pathway; positive regulation of protein kinase activity; toll-like receptor signaling pathway; innate immune response; toll-like receptor 9 signaling pathway; inflammatory response; toll-like receptor 4 signaling pathway; regulation of cytokine biosynthetic process; cardiac muscle contraction