Western Blot (WB)
(LYSMD2 antibody (MBS5302530) used at 1 ug/ml to detect target protein.)
Rabbit anti-Human, Mouse LYSMD2 Polyclonal Antibody | anti-LYSMD2 antibody
LYSMD2 antibody
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
LYSMD2; Polyclonal Antibody; LYSMD2 antibody; Polyclonal LYSMD2; Anti-LYSMD2; Lysm Putative Peptidoglycan-Binding Domain Containing 2; DKFZp686I2243; LYSMD-2; LYSMD 2; MGC35274; anti-LYSMD2 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Specificity
LYSMD2 antibody was raised against the middle region of LYSMD2
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LYSMD2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
124
Applicable Applications for anti-LYSMD2 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of LYSMD2 protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human,Mouse
Immunogen
LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(LYSMD2 antibody (MBS5302530) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(LYSMD2 antibody (MBS5302530) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-LYSMD2 antibody
Rabbit polyclonal LYSMD2 antibody raised against the middle region of LYSMD2
Product Categories/Family for anti-LYSMD2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
23 kDa (MW of target protein)
NCBI Official Full Name
LYSMD2 protein
NCBI Official Synonym Full Names
LysM, putative peptidoglycan-binding, domain containing 2
NCBI Official Symbol
LYSMD2
NCBI Protein Information
lysM and putative peptidoglycan-binding domain-containing protein 2
UniProt Protein Name
LysM and putative peptidoglycan-binding domain-containing protein 2
UniProt Gene Name
LYSMD2
UniProt Entry Name
LYSM2_HUMAN
Uniprot Description
MGC35274: a protein of unknown function. Contains one LysM (lysin motif) found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 15q21.2
Similar Products
Product Notes
The LYSMD2 lysmd2 (Catalog #AAA5302530) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LYSMD2 antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's LYSMD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the LYSMD2 lysmd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LYSMD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
