Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LYK5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:500Positive Control: Human Spleen)

Rabbit LYK5 Polyclonal Antibody | anti-STRADA antibody

LYK5 antibody - N-terminal region

Gene Names
STRADA; LYK5; PMSE; Stlk; STRAD; NY-BR-96; STRAD alpha
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LYK5; Polyclonal Antibody; LYK5 antibody - N-terminal region; anti-STRADA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNL
Sequence Length
394
Applicable Applications for anti-STRADA antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LYK5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LYK5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:500Positive Control: Human Spleen)

Western Blot (WB) (WB Suggested Anti-LYK5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:500Positive Control: Human Spleen)
Related Product Information for anti-STRADA antibody
This is a rabbit polyclonal antibody against LYK5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LYK5 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. It contains 1 protein kinase domain. LYK5 is a pseudokinase which, in complex with CAB39, binds to and activates STK11. It relocates STK11 from the nucleus
Product Categories/Family for anti-STRADA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
STE20-related kinase adapter protein alpha isoform 2
NCBI Official Synonym Full Names
STE20 related adaptor alpha
NCBI Official Symbol
STRADA
NCBI Official Synonym Symbols
LYK5; PMSE; Stlk; STRAD; NY-BR-96; STRAD alpha
NCBI Protein Information
STE20-related kinase adapter protein alpha
UniProt Protein Name
STE20-related kinase adapter protein alpha
UniProt Gene Name
STRADA
UniProt Synonym Gene Names
LYK5; STRAD; STRAD alpha
UniProt Entry Name
STRAA_HUMAN

NCBI Description

The protein encoded by this gene contains a STE20-like kinase domain, but lacks several residues that are critical for catalytic activity, so it is termed a 'pseudokinase'. The protein forms a heterotrimeric complex with serine/threonine kinase 11 (STK11, also known as LKB1) and the scaffolding protein calcium binding protein 39 (CAB39, also known as MO25). The protein activates STK11 leading to the phosphorylation of both proteins and excluding STK11 from the nucleus. The protein is necessary for STK11-induced G1 cell cycle arrest. A mutation in this gene has been shown to result in polyhydramnios, megalencephaly, and symptomatic epilepsy (PMSE) syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described but their full-length nature is not known. [provided by RefSeq, Sep 2009]

Uniprot Description

STRAD: a pseudokinase which, in complex with CAB39, binds to and activates LKB1. Relocates LKB1 from the nucleus to the cytoplasm. Plays an essential role in LKB1-mediated G1 cell cycle arrest. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, protein; Motility/polarity/chemotaxis; Protein kinase, Ser/Thr (non-receptor); Protein kinase, STE; STE group; STE20 family; STLK subfamily

Chromosomal Location of Human Ortholog: 17q23.3

Cellular Component: nucleoplasm; cytoplasm; nucleus; cytosol

Molecular Function: protein serine/threonine kinase activator activity; protein binding; kinase binding; protein kinase activator activity; ATP binding; protein kinase activity; receptor signaling protein serine/threonine kinase activity

Biological Process: activation of protein kinase activity; insulin receptor signaling pathway; mitotic cell cycle; protein export from nucleus; cell cycle arrest; protein amino acid phosphorylation

Disease: Polyhydramnios, Megalencephaly, And Symptomatic Epilepsy

Research Articles on STRADA

Similar Products

Product Notes

The STRADA strada (Catalog #AAA3209318) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LYK5 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LYK5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STRADA strada for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSFLTNDASS ESIASFSKQE VMSSFLPEGG CYELLTVIGK GFEDLMTVNL. It is sometimes possible for the material contained within the vial of "LYK5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.