Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of LY6E expression in transfected 293T cell line using L7715-05Q: Lane 1: LY6E transfected lysate (13.50kD) Lane 2: Non-transfected lysate)

Rabbit anti-Human LY6E Polyclonal Antibody | anti-LY6E antibody

LY6E (Lymphocyte Antigen 6E, Ly-6E, Retinoic Acid-induced Gene E Protein, RIG-E, Stem Cell Antigen 2, SCA-2, Thymic Shared Antigen 1, TSA-1, 9804, RIGE, SCA2, TSA1) (AP)

Gene Names
LY6E; RIGE; SCA2; RIG-E; SCA-2; TSA-1
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
LY6E; Polyclonal Antibody; LY6E (Lymphocyte Antigen 6E; Ly-6E; Retinoic Acid-induced Gene E Protein; RIG-E; Stem Cell Antigen 2; SCA-2; Thymic Shared Antigen 1; TSA-1; 9804; RIGE; SCA2; TSA1) (AP); anti-LY6E antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LY6E in transfected cells.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-LY6E antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length protein corresponding to aa1-131 from human LY6E.
Immunogen Sequence
MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LY6E expression in transfected 293T cell line using L7715-05Q: Lane 1: LY6E transfected lysate (13.50kD) Lane 2: Non-transfected lysate)

Western Blot (WB) (Western Blot analysis of LY6E expression in transfected 293T cell line using L7715-05Q: Lane 1: LY6E transfected lysate (13.50kD) Lane 2: Non-transfected lysate)
Product Categories/Family for anti-LY6E antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,507 Da
NCBI Official Full Name
lymphocyte antigen 6E
NCBI Official Synonym Full Names
lymphocyte antigen 6 complex, locus E
NCBI Official Symbol
LY6E
NCBI Official Synonym Symbols
RIGE; SCA2; RIG-E; SCA-2; TSA-1
NCBI Protein Information
lymphocyte antigen 6E
UniProt Protein Name
Lymphocyte antigen 6E
Protein Family
UniProt Gene Name
LY6E
UniProt Synonym Gene Names
9804; RIGE; SCA2; TSA1; Ly-6E; RIG-E; SCA-2; TSA-1
UniProt Entry Name
LY6E_HUMAN

Uniprot Description

LY6E: Induced by retinoic acid; in promyelocytic leukemia NB4 and in myeloblast HL-60 cell lines. Activated by IFN-alpha in monocytic cell line U-937 and in peripheral blood monocyte cells.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: integral to plasma membrane

Biological Process: epinephrine secretion; organ growth; cell surface receptor linked signal transduction; in utero embryonic development; adrenal gland development; ventricular cardiac muscle morphogenesis; norepinephrine metabolic process

Similar Products

Product Notes

The LY6E ly6e (Catalog #AAA6485594) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LY6E (Lymphocyte Antigen 6E, Ly-6E, Retinoic Acid-induced Gene E Protein, RIG-E, Stem Cell Antigen 2, SCA-2, Thymic Shared Antigen 1, TSA-1, 9804, RIGE, SCA2, TSA1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LY6E can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LY6E ly6e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LY6E, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.