Western Blot (WB)
(WB Suggested Anti-LTB4R Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: PANC1 cell lysate)
Rabbit anti-Human LTB4R Polyclonal Antibody | anti-LTB4R antibody
LTB4R antibody - C-terminal region
Gene Names
LTB4R; BLT1; BLTR; P2Y7; GPR16; LTBR1; P2RY7; CMKRL1; LTB4R1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LTB4R; Polyclonal Antibody; LTB4R antibody - C-terminal region; anti-LTB4R antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVG
Sequence Length
352
Applicable Applications for anti-LTB4R antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human LTB4R
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-LTB4R Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: PANC1 cell lysate)
Western Blot (WB)
(WB Suggested Anti-LTB4R Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: PANC1 cell lysate)
Related Product Information for anti-LTB4R antibody
This is a rabbit polyclonal antibody against LTB4R. It was validated on Western Blot
Target Description: LTB4R is the receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. LTB4R may be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. LTB4R is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response.
Target Description: LTB4R is the receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. LTB4R may be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. LTB4R is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response.
Product Categories/Family for anti-LTB4R antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
leukotriene B4 receptor 1
NCBI Official Synonym Full Names
leukotriene B4 receptor
NCBI Official Symbol
LTB4R
NCBI Official Synonym Symbols
BLT1; BLTR; P2Y7; GPR16; LTBR1; P2RY7; CMKRL1; LTB4R1
NCBI Protein Information
leukotriene B4 receptor 1
UniProt Protein Name
Leukotriene B4 receptor 1
Protein Family
UniProt Gene Name
LTB4R
UniProt Synonym Gene Names
BLT; BLT1; BLTR; CMKRL1; GPR16; P2RY7; LTB4-R 1; LTB4-R1; P2Y7
Uniprot Description
Receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. May be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. Is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response.
Research Articles on LTB4R
Similar Products
Product Notes
The LTB4R ltb4r (Catalog #AAA3200297) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LTB4R antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LTB4R can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LTB4R ltb4r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGQAAGLGLV GKRLSLARNV LIALAFLSSS VNPVLYACAG GGLLRSAGVG. It is sometimes possible for the material contained within the vial of "LTB4R, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
