Western Blot (WB)
(LSM14A polyclonal antibody. Western Blot analysis of LSM14A expression in human placenta.)
Mouse anti-Human LSM14A Polyclonal Antibody
LSM14A (C19orf13, FAM61A, RAP55, RAP55A, Protein LSM14 Homolog A, Protein FAM61A, Protein SCD6 Homolog, Putative alpha-synuclein-binding Protein, RNA-associated Protein 55A)
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
LSM14A; Polyclonal Antibody; LSM14A (C19orf13; FAM61A; RAP55; RAP55A; Protein LSM14 Homolog A; Protein FAM61A; Protein SCD6 Homolog; Putative alpha-synuclein-binding Protein; RNA-associated Protein 55A); Anti -LSM14A (C19orf13; anti-LSM14A antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LSM14A.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSTSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVSTRPLPSASQKAGENQEHRRAEVHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRGRFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGGRGRGGGRGGTFTAPRGFRGGFRGGRGGREFADFEYRKDNKVAA
Applicable Applications for anti-LSM14A antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human LSM14A, aa1-463 (AAH16842.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(LSM14A polyclonal antibody. Western Blot analysis of LSM14A expression in human placenta.)
Western Blot (WB)
(LSM14A polyclonal antibody. Western Blot analysis of LSM14A expression in human placenta.)
Western Blot (WB)
(Western Blot analysis of LSM14A expression in transfected 293T cell line by LSM14A polyclonal antibody. Lane 1: LSM14A transfected lysate (50.93kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of LSM14A expression in transfected 293T cell line by LSM14A polyclonal antibody. Lane 1: LSM14A transfected lysate (50.93kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-LSM14A antibody
Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
Product Categories/Family for anti-LSM14A antibody
NCBI and Uniprot Product Information
Similar Products
Product Notes
The LSM14A (Catalog #AAA6011174) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LSM14A (C19orf13, FAM61A, RAP55, RAP55A, Protein LSM14 Homolog A, Protein FAM61A, Protein SCD6 Homolog, Putative alpha-synuclein-binding Protein, RNA-associated Protein 55A) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LSM14A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the LSM14A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSGGTPYIGS KISLISKAEI RYEGILYTID TENSTVALAK VRSFGTEDRP TDRPIPPRDE VFEYIIFRGS DIKDLTVCEP PKPQCSLPQD PAIVQSSLGS STSSFQSMGS YGPFGRMPTY SQFSPSSLVG QQFGAVGVAG SSLTSFGTET SNSGTLPQSS AVGSAFTQDT RSLKTQLSQG RSSPQLDPLR KSPTMEQAVQ TASAHLPAPA AVGRRSPVST RPLPSASQKA GENQEHRRAE VHKVSRPENE QLRNDNKRQV APGAPSAPRR GRGGHRGGRG RFGIRRDGPM KFEKDFDFES ANAQFNKEEI DREFHNKLKL KEDKLEKQEK PVNGEDKGDS GVDTQNSEGN ADEEDPLGPN CYYDKTKSFF DNISCDDNRE RRPTWAEERR LNAETFGIPL RPNRGRGGYR GRGGLGFRGG RGRGGGRGGT FTAPRGFRGG FRGGRGGREF ADFEYRKDNK VAA. It is sometimes possible for the material contained within the vial of "LSM14A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
