Western Blot (WB)
(LRRC49 antibody (MBS5301424) used at 1 ug/ml to detect target protein.)
Rabbit LRRC49 Polyclonal Antibody | anti-LRRC49 antibody
LRRC49 antibody
Gene Names
LRRC49; PGs4
Applications
Western Blot
Purity
Affinity purified
Synonyms
LRRC49; Polyclonal Antibody; LRRC49 antibody; Polyclonal LRRC49; Anti-LRRC49; LRRC-49; LRRC 49; Leucine Rich Repeat Containing 49; FLJ20156; anti-LRRC49 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
LRRC49 antibody was raised against the N terminal of LRRC49
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC49 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
676
Applicable Applications for anti-LRRC49 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of LRRC49 protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human, Mouse, Rat
Immunogen
LRRC49 antibody was raised using the N terminal of LRRC49 corresponding to a region with amino acids KVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINLVSSSLSSFPILQRS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(LRRC49 antibody (MBS5301424) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(LRRC49 antibody (MBS5301424) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-LRRC49 antibody
Rabbit polyclonal LRRC49 antibody raised against the N terminal of LRRC49
Product Categories/Family for anti-LRRC49 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
79 kDa (MW of target protein)
NCBI Official Full Name
leucine-rich repeat-containing protein 49 isoform 4
NCBI Official Synonym Full Names
leucine rich repeat containing 49
NCBI Official Symbol
LRRC49
NCBI Official Synonym Symbols
PGs4
NCBI Protein Information
leucine-rich repeat-containing protein 49
UniProt Protein Name
Leucine-rich repeat-containing protein 49
Protein Family
UniProt Gene Name
LRRC49
UniProt Synonym Gene Names
PGs4
UniProt Entry Name
LRC49_HUMAN
Uniprot Description
LRRC49: Part of the neuronal tubulin polyglutamylase complex which contains C19orf20/PGs1, C18orf10/PGs2, TTLL1, LRRC49 and NICN1.
Protein type: Cytoskeletal
Chromosomal Location of Human Ortholog: 15q23
Cellular Component: microtubule; cytoplasm
Research Articles on LRRC49
Similar Products
Product Notes
The LRRC49 lrrc49 (Catalog #AAA5301424) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's LRRC49 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the LRRC49 lrrc49 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LRRC49, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
