Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Lanes :Human placenta Primary Antibody Dilution :1:500 Secondary Antibody :Anti-rabbit-HRP Secondary Antibody Dilution :1:5000 Gene Name :Brown: LRP1 Purple: Haemotoxylin Submitted by :LRP1)

Rabbit anti-Human LRP1 Polyclonal Antibody | anti-LRP1 antibody

LRP1 antibody - middle region

Gene Names
LRP1; APR; KPA; LRP; A2MR; CD91; APOER; LRP1A; TGFBR5; IGFBP3R; IGFBP-3R; IGFBP3R1
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
LRP1; Polyclonal Antibody; LRP1 antibody - middle region; anti-LRP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR
Sequence Length
439
Applicable Applications for anti-LRP1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LRP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Lanes :Human placenta Primary Antibody Dilution :1:500 Secondary Antibody :Anti-rabbit-HRP Secondary Antibody Dilution :1:5000 Gene Name :Brown: LRP1 Purple: Haemotoxylin Submitted by :LRP1)

Immunohistochemistry (IHC) (Lanes :Human placenta Primary Antibody Dilution :1:500 Secondary Antibody :Anti-rabbit-HRP Secondary Antibody Dilution :1:5000 Gene Name :Brown: LRP1 Purple: Haemotoxylin Submitted by :LRP1)
Related Product Information for anti-LRP1 antibody
This is a rabbit polyclonal antibody against LRP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Low-density lipoprotein receptor-related protein 1 (.-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane.
Product Categories/Family for anti-LRP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
LRP1 protein
NCBI Official Synonym Full Names
LDL receptor related protein 1
NCBI Official Symbol
LRP1
NCBI Official Synonym Symbols
APR; KPA; LRP; A2MR; CD91; APOER; LRP1A; TGFBR5; IGFBP3R; IGFBP-3R; IGFBP3R1
NCBI Protein Information
prolow-density lipoprotein receptor-related protein 1
UniProt Protein Name
Prolow-density lipoprotein receptor-related protein 1
UniProt Gene Name
LRP1
UniProt Synonym Gene Names
A2MR; APR; LRP-1; A2MR; APOER; LRP-85; LRP-515; LRPICD
UniProt Entry Name
LRP1_HUMAN

NCBI Description

This gene encodes a member of the low-density lipoprotein receptor family of proteins. The encoded preproprotein is proteolytically processed by furin to generate 515 kDa and 85 kDa subunits that form the mature receptor (PMID: 8546712). This receptor is involved in several cellular processes, including intracellular signaling, lipid homeostasis, and clearance of apoptotic cells. In addition, the encoded protein is necessary for the alpha 2-macroglobulin-mediated clearance of secreted amyloid precursor protein and beta-amyloid, the main component of amyloid plaques found in Alzheimer patients. Expression of this gene decreases with age and has been found to be lower than controls in brain tissue from Alzheimer's disease patients. [provided by RefSeq, Oct 2015]

Uniprot Description

LRP1: a receptor involved in endocytosis, phagocytosis of apoptotic cells, and neural signaling. Modulates cellular events including APP metabolism, kinase-dependent intracellular signaling, neuronal calcium signaling and neurotransmission. Involved in the plasma clearance of chylomicron remnants and activated alpha 2-macroglobulin, as well as the local metabolism of complexes between plasminogen activators and their endogenous inhibitors. Plays a fundamental role in cellular signaling pathways in the brain. Mediates neural NMDA gating via a complex of LRP1, PSD-95 and NMDAR. A type I membrane protein. After cleavage, the intracellular domain (LRPICD) is detected both in the cytoplasm and in the nucleus. Most abundant in liver, brain and lung.

Protein type: Motility/polarity/chemotaxis; Cell surface; Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: focal adhesion; cell soma; clathrin-coated vesicle; integral to plasma membrane; lysosomal membrane; dendrite; cytoplasm; nucleolus; plasma membrane; coated pit; receptor complex; endosome

Molecular Function: protein binding; lipoprotein transporter activity; protease binding; protein complex binding; apolipoprotein binding; receptor activity; calcium ion binding

Biological Process: phototransduction, visible light; cholesterol metabolic process; receptor-mediated endocytosis; regulation of phospholipase A2 activity; negative regulation of Wnt receptor signaling pathway; lipoprotein metabolic process; negative regulation of smooth muscle cell migration; positive regulation of protein transport; positive regulation of lipid transport; cell proliferation; lipoprotein transport; regulation of actin cytoskeleton organization and biogenesis; protein kinase C activation; negative regulation of neuron apoptosis; retinoid metabolic process; regulation of cholesterol transport; apoptotic cell clearance; aging

Research Articles on LRP1

Similar Products

Product Notes

The LRP1 lrp1 (Catalog #AAA3213953) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LRP1 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LRP1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the LRP1 lrp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ATYLSGAQVS TITPTSTRQT TAMDFSYANE TVCWVHVGDS AAQTQLKCAR. It is sometimes possible for the material contained within the vial of "LRP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.