Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LRG1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Rabbit LRG1 Polyclonal Antibody | anti-LRG1 antibody

LRG1 antibody - N-terminal region

Gene Names
LRG1; LRG; HMFT1766
Reactivity
Cow, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LRG1; Polyclonal Antibody; LRG1 antibody - N-terminal region; anti-LRG1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP
Sequence Length
347
Applicable Applications for anti-LRG1 antibody
Western Blot (WB)
Homology
Cow: 79%; Human: 100%; Pig: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LRG1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LRG1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-LRG1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Related Product Information for anti-LRG1 antibody
This is a rabbit polyclonal antibody against LRG1. It was validated on Western Blot

Target Description: The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O'Donnell et al., 2002 [PubMed 12223515]).
Product Categories/Family for anti-LRG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
leucine-rich alpha-2-glycoprotein
NCBI Official Synonym Full Names
leucine rich alpha-2-glycoprotein 1
NCBI Official Symbol
LRG1
NCBI Official Synonym Symbols
LRG; HMFT1766
NCBI Protein Information
leucine-rich alpha-2-glycoprotein
UniProt Protein Name
Leucine-rich alpha-2-glycoprotein
UniProt Gene Name
LRG1
UniProt Synonym Gene Names
LRG; LRG
UniProt Entry Name
A2GL_HUMAN

NCBI Description

The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O'Donnell et al., 2002 [PubMed 12223515]).[supplied by OMIM, Mar 2008]

Uniprot Description

LRG1:

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: extracellular space; membrane; extracellular region

Molecular Function: transforming growth factor beta receptor binding

Biological Process: positive regulation of angiogenesis; positive regulation of transforming growth factor beta receptor signaling pathway; brown fat cell differentiation; positive regulation of endothelial cell proliferation

Research Articles on LRG1

Similar Products

Product Notes

The LRG1 lrg1 (Catalog #AAA3210807) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LRG1 antibody - N-terminal region reacts with Cow, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's LRG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LRG1 lrg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GVTLSPKDCQ VFRSDHGSSI SCQPPAEIPG YLPADTVHLA VEFFNLTHLP. It is sometimes possible for the material contained within the vial of "LRG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.