Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: LRATSample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human, Pig LRAT Polyclonal Antibody | anti-LRAT antibody

LRAT Antibody - N-terminal region

Gene Names
LRAT; LCA14
Reactivity
Human, Pig
Purity
Affinity purified
Synonyms
LRAT; Polyclonal Antibody; LRAT Antibody - N-terminal region; anti-LRAT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKNPMLEVVSLLLEKLLLISNFTLFSSGAAGEDKGRNSFYETSSFHRGDV
Sequence Length
230
Homology
Human: 100%; Pig: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LRAT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LRATSample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: LRATSample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-LRAT antibody
lecithin retinol acyltransferase (phosphatidylcholine--retinol O-acyltransferase)

Target Description: The protein encoded by this gene localizes to the endoplasmic reticulum, where it catalyzes the esterification of all-trans-retinol into all-trans-retinyl ester. This reaction is an important step in vitamin A metabolism in the visual system. Mutations in this gene have been associated with early-onset severe retinal dystrophy and Leber congenital amaurosis 14. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-LRAT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
lecithin retinol acyltransferase
NCBI Official Synonym Full Names
lecithin retinol acyltransferase
NCBI Official Symbol
LRAT
NCBI Official Synonym Symbols
LCA14
NCBI Protein Information
lecithin retinol acyltransferase
UniProt Protein Name
Lecithin retinol acyltransferase
UniProt Gene Name
LRAT
UniProt Entry Name
LRAT_HUMAN

NCBI Description

The protein encoded by this gene localizes to the endoplasmic reticulum, where it catalyzes the esterification of all-trans-retinol into all-trans-retinyl ester. This reaction is an important step in vitamin A metabolism in the visual system. Mutations in this gene have been associated with early-onset severe retinal dystrophy and Leber congenital amaurosis 14. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014]

Uniprot Description

LRAT: Transfers the acyl group from the sn-1 position of phosphatidylcholine to all-trans retinol, producing all-trans retinyl esters. Retinyl esters are storage forms of vitamin A. LRAT plays a critical role in vision. It provides the all-trans retinyl ester substrates for the isomerohydrolase which processes the esters into 11-cis-retinol in the retinal pigment epithelium; due to a membrane-associated alcohol dehydrogenase, 11 cis-retinol is oxidized and converted into 11-cis-retinaldehyde which is the chromophore for rhodopsin and the cone photopigments. Defects in LRAT are a cause of Leber congenital amaurosis type 14 (LCA14). It is a severe dystrophy of the retina, typically becoming evident in the first years of life. Visual function is usually poor and often accompanied by nystagmus, sluggish or near-absent pupillary responses, photophobia, high hyperopia and keratoconus. Belongs to the H-rev107 family.

Protein type: Transferase; Cofactor and Vitamin Metabolism - retinol; Membrane protein, integral; EC 2.3.1.135

Chromosomal Location of Human Ortholog: 4q32.1

Cellular Component: multivesicular body; endoplasmic reticulum membrane; rough endoplasmic reticulum; perinuclear region of cytoplasm; integral to membrane

Molecular Function: retinoic acid binding; transferase activity, transferring acyl groups; retinol binding; phosphatidylcholine-retinol O-acyltransferase activity

Biological Process: positive regulation of lipid transport; phototransduction, visible light; visual perception; retinol metabolic process; retinoic acid metabolic process; retinoid metabolic process; vitamin A metabolic process

Disease: Leber Congenital Amaurosis 14; Retinitis Pigmentosa

Research Articles on LRAT

Similar Products

Product Notes

The LRAT lrat (Catalog #AAA3214507) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LRAT Antibody - N-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKNPMLEVVS LLLEKLLLIS NFTLFSSGAA GEDKGRNSFY ETSSFHRGDV. It is sometimes possible for the material contained within the vial of "LRAT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.