Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Figure 1. Western blot analysis of GAD65/GAD2 using anti- GAD65/GAD2 antibody (MBS1754021).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat brain tissue lysatesLane 2: mouse brain tissue lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with mouse anti- GAD65/GAD2 antigen affinity purified monoclonal antibody (Catalog # MBS1754021) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # MBS176445) with Tanon 5200 system. A specific band was detected for GAD65/GAD2 at approximately 65KD. The expected band size for GAD65/GAD2 is at 65KD. )

Mouse anti-Mouse, Rat GAD65/GAD2 Monoclonal Antibody | anti-GAD2 antibody

Anti-GAD65/GAD2 Antibody (monoclonal, 4E12)

Gene Names
GAD2; GAD65
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
GAD65/GAD2; Monoclonal Antibody; Anti-GAD65/GAD2 Antibody (monoclonal; 4E12); Glutamate decarboxylase 2; 65 kDa glutamic acid decarboxylase; GAD-65; Glutamate decarboxylase 65 kDa isoform; GAD2; GAD65; glutamate decarboxylase 2 (pancreatic islets and brain; 65kDa); anti-GAD2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Mouse, Rat
Clonality
Monoclonal
Isotype
Mouse IgG1
Clone Number
4E12
Specificity
Mouse IgG monoclonal antibody for GAD65/GAD2 detection.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.01mg NaN3.
Applicable Applications for anti-GAD2 antibody
Western Blot (WB)
Application Notes
WB: 0.1-0.5ug/ml|Mouse, Rat|
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65 (131-164aa KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ), different from the related mouse and rat sequences by one amino acid.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems
Recommended Detection Systems
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of GAD65/GAD2 using anti- GAD65/GAD2 antibody (MBS1754021).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat brain tissue lysatesLane 2: mouse brain tissue lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with mouse anti- GAD65/GAD2 antigen affinity purified monoclonal antibody (Catalog # MBS1754021) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # MBS176445) with Tanon 5200 system. A specific band was detected for GAD65/GAD2 at approximately 65KD. The expected band size for GAD65/GAD2 is at 65KD. )

Western Blot (WB) (Figure 1. Western blot analysis of GAD65/GAD2 using anti- GAD65/GAD2 antibody (MBS1754021).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat brain tissue lysatesLane 2: mouse brain tissue lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with mouse anti- GAD65/GAD2 antigen affinity purified monoclonal antibody (Catalog # MBS1754021) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # MBS176445) with Tanon 5200 system. A specific band was detected for GAD65/GAD2 at approximately 65KD. The expected band size for GAD65/GAD2 is at 65KD. )
Related Product Information for anti-GAD2 antibody
Glutamate decarboxylase 2, also known as GAD65, is an enzyme that in humans is encoded by the GAD2 gene. This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein.
References
1. "Entrez Gene: GAD2 glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa)".
2. Meyre, D., Boutin, P., Tounian, A., Deweirder, M., Aout, M., Jouret, B., Heude, B., Weill, J., Tauber, M., Tounian, P., Froguel, P. Is glutamate decarboxylase 2 (GAD2) a genetic link between low birth weight and subsequent development of obesity in children. J. Clin. Endocr. Metab. 90: 2384-2390, 2005.
3. Zhang, Z., Cai, Y. Q., Zou, F., Bie, B., Pan, Z. Z. Epigenetic suppression of GAD65 expression mediates persistent pain. Nature Med. 17: 1448-1455, 2011.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65,411 Da
NCBI Official Full Name
glutamate decarboxylase 2
NCBI Official Synonym Full Names
glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa)
NCBI Official Symbol
GAD2
NCBI Official Synonym Symbols
GAD65
NCBI Protein Information
glutamate decarboxylase 2; GAD-65; 65 kDa glutamic acid decarboxylase; Glutamate decarboxylase-2 (pancreas); glutamate decarboxylase 65 kDa isoform
UniProt Protein Name
Glutamate decarboxylase 2
Protein Family
UniProt Gene Name
GAD2
UniProt Synonym Gene Names
GAD65; GAD-65
UniProt Entry Name
DCE2_HUMAN

NCBI Description

This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Oct 2008]

Uniprot Description

GAD2: Catalyzes the production of GABA. Homodimer. Belongs to the group II decarboxylase family.

Protein type: Other Amino Acids Metabolism - taurine and hypotaurine; Lyase; Other Amino Acids Metabolism - beta-alanine; Carbohydrate Metabolism - butanoate; EC 4.1.1.15; Amino Acid Metabolism - alanine, aspartate and glutamate

Chromosomal Location of Human Ortholog: 10p11.23

Cellular Component: presynaptic membrane; Golgi membrane; synaptic vesicle membrane; axon; perinuclear region of cytoplasm; plasma membrane; cytosol; cell junction

Molecular Function: protein binding; glutamate binding; glutamate decarboxylase activity; protein heterodimerization activity; pyridoxal phosphate binding

Biological Process: response to drug; synaptic transmission; glutamate decarboxylation to succinate; neurotransmitter secretion; neurotransmitter biosynthetic process

Research Articles on GAD2

Similar Products

Product Notes

The GAD2 gad2 (Catalog #AAA1754021) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-GAD65/GAD2 Antibody (monoclonal, 4E12) reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GAD65/GAD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.1-0.5ug/ml|Mouse, Rat|. Researchers should empirically determine the suitability of the GAD2 gad2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GAD65/GAD2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.