Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Lpcat2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)

Rabbit Lpcat2 Polyclonal Antibody | anti-LPCAT2 antibody

Lpcat2 antibody - N-terminal region

Gene Names
Lpcat2; Aytl1; Aytl1a; lpafat1; lysoPAFAT; 1-AGPAT 11; A330042H22; lysoPAFAT/LPCAT2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Lpcat2; Polyclonal Antibody; Lpcat2 antibody - N-terminal region; anti-LPCAT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NENAQTPLVGRLLRALQPVLVSRVDPDSRKNTINEIKKRATSGGEWPQIL
Sequence Length
544
Applicable Applications for anti-LPCAT2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Lpcat2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)

Western Blot (WB) (WB Suggested Anti-Lpcat2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)
Related Product Information for anti-LPCAT2 antibody
This is a rabbit polyclonal antibody against Lpcat2. It was validated on Western Blot

Target Description: Lpcat2 possesses both acyltransferase and acetyltransferase activities. Activity is calcium-dependent. It is involved in platelet-activating factor (PAF) biosynthesis by catalyzing the conversion of the PAF precursor, 1-O-alkyl-sn-glycero-3-phosphocholine (lyso-PAF) into 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine (PAF). It also converts lyso-PAF to 1-alkyl-phosphatidylcholine (PC), a major component of cell membranes and a PAF precursor. Under resting conditions, acyltransferase activity is preferred. Upon acute inflammatory stimulus, acetyltransferase activity is enhanced and PAF synthesis increases.
Product Categories/Family for anti-LPCAT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
lysophosphatidylcholine acyltransferase 2 isoform a
NCBI Official Synonym Full Names
lysophosphatidylcholine acyltransferase 2
NCBI Official Symbol
Lpcat2
NCBI Official Synonym Symbols
Aytl1; Aytl1a; lpafat1; lysoPAFAT; 1-AGPAT 11; A330042H22; lysoPAFAT/LPCAT2
NCBI Protein Information
lysophosphatidylcholine acyltransferase 2
UniProt Protein Name
Lysophosphatidylcholine acyltransferase 2
UniProt Gene Name
Lpcat2
UniProt Synonym Gene Names
Aytl1; Aytl1a; Lpcat2a; LPC acyltransferase 2; LPCAT-2; LysoPC acyltransferase 2; 1-AGP acyltransferase 11; 1-AGPAT 11; Acetyl-CoA:lyso-PAF acetyltransferase; Lyso-PAF acetyltransferase; LysoPAFAT

Uniprot Description

Possesses both acyltransferase and acetyltransferase activities (PubMed:17182612, PubMed:18156367). Activity is calcium-dependent (PubMed:17182612). Involved in platelet-activating factor (PAF) biosynthesis by catalyzing the conversion of the PAF precursor, 1-O-alkyl-sn-glycero-3-phosphocholine (lyso-PAF) into 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine (PAF) (PubMed:17182612). Also converts lyso-PAF to 1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine (PC), a major component of cell membranes and a PAF precursor (PubMed:17182612, PubMed:18156367). Under resting conditions, acyltransferase activity is preferred (PubMed:17182612). Upon acute inflammatory stimulus, acetyltransferase activity is enhanced and PAF synthesis increases (PubMed:17182612). Also catalyzes the conversion of 1-acyl-sn-glycero-3-phosphocholine to 1,2-diacyl-sn-glycero-3-phosphocholine. Involved in the regulation of lipid droplet number and size ().

Research Articles on LPCAT2

Similar Products

Product Notes

The LPCAT2 lpcat2 (Catalog #AAA3208530) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Lpcat2 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Lpcat2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LPCAT2 lpcat2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NENAQTPLVG RLLRALQPVL VSRVDPDSRK NTINEIKKRA TSGGEWPQIL. It is sometimes possible for the material contained within the vial of "Lpcat2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.