Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PCAT1Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human LPCAT1 Polyclonal Antibody | anti-LPCAT1 antibody

LPCAT1 Antibody - C-terminal region

Gene Names
LPCAT1; AYTL2; lpcat; AGPAT9; PFAAP3; AGPAT10; LPCAT-1; lysoPAFAT
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LPCAT1; Polyclonal Antibody; LPCAT1 Antibody - C-terminal region; anti-LPCAT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD
Sequence Length
534
Applicable Applications for anti-LPCAT1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PCAT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PCAT1Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PCAT1Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-LPCAT1 antibody
This is a rabbit polyclonal antibody against PCAT1. It was validated on Western Blot

Target Description: This gene encodes a member of the 1-acyl-sn-glycerol-3-phosphate acyltransferase family of proteins. The encoded enzyme plays a role in phospholipid metabolism, specifically in the conversion of lysophosphatidylcholine to phosphatidylcholine in the presence of acyl-CoA. This process is important in the synthesis of lung surfactant and platelet-activating factor (PAF). Elevated expression of this gene may contribute to the progression of oral squamous cell, prostate, breast, and other human cancers.
Product Categories/Family for anti-LPCAT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
lysophosphatidylcholine acyltransferase 1
NCBI Official Synonym Full Names
lysophosphatidylcholine acyltransferase 1
NCBI Official Symbol
LPCAT1
NCBI Official Synonym Symbols
AYTL2; lpcat; AGPAT9; PFAAP3; AGPAT10; LPCAT-1; lysoPAFAT
NCBI Protein Information
lysophosphatidylcholine acyltransferase 1
UniProt Protein Name
Lysophosphatidylcholine acyltransferase 1
UniProt Gene Name
LPCAT1
UniProt Synonym Gene Names
AYTL2; PFAAP3; LPC acyltransferase 1; LPCAT-1; LysoPC acyltransferase 1; Acetyl-CoA:lyso-PAF acetyltransferase; Lyso-PAF acetyltransferase; LysoPAFAT
UniProt Entry Name
PCAT1_HUMAN

NCBI Description

This gene encodes a member of the 1-acyl-sn-glycerol-3-phosphate acyltransferase family of proteins. The encoded enzyme plays a role in phospholipid metabolism, specifically in the conversion of lysophosphatidylcholine to phosphatidylcholine in the presence of acyl-CoA. This process is important in the synthesis of lung surfactant and platelet-activating factor (PAF). Elevated expression of this gene may contribute to the progression of oral squamous cell, prostate, breast, and other human cancers. [provided by RefSeq, Sep 2016]

Uniprot Description

LPCAT1: Possesses both acyltransferase and acetyltransferase activities. Activity is calcium-independent. Mediates the conversion of 1-acyl-sn-glycero-3-phosphocholine (LPC) into phosphatidylcholine (PC). Displays a clear preference for saturated fatty acyl-CoAs, and 1-myristoyl or 1-palmitoyl LPC as acyl donors and acceptors, respectively. May synthesize phosphatidylcholine in pulmonary surfactant, thereby playing a pivotal role in respiratory physiology. Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.

Protein type: Acetyltransferase; EC 2.3.1.67; Endoplasmic reticulum; Membrane protein, integral; EC 2.3.1.23

Chromosomal Location of Human Ortholog: 5p15.33

Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum membrane; membrane; endoplasmic reticulum; integral to membrane; lipid particle

Molecular Function: 1-alkylglycerophosphocholine O-acetyltransferase activity; 1-alkenylglycerophosphocholine O-acyltransferase activity; 1-acylglycerophosphocholine O-acyltransferase activity; 1-alkylglycerophosphocholine O-acyltransferase activity; calcium ion binding

Biological Process: retina development in camera-type eye; phospholipid metabolic process; glycerophospholipid biosynthetic process; positive regulation of protein catabolic process; phosphatidic acid biosynthetic process; triacylglycerol biosynthetic process; cellular lipid metabolic process; surfactant homeostasis; phospholipid biosynthetic process

Research Articles on LPCAT1

Similar Products

Product Notes

The LPCAT1 lpcat1 (Catalog #AAA3219515) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LPCAT1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LPCAT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LPCAT1 lpcat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AFAEEYLYPD QTHFESCAET SPAPIPNGFC ADFSPENSDA GRKPVRKKLD. It is sometimes possible for the material contained within the vial of "LPCAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.