Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: LIPASample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Rabbit LIPA Polyclonal Antibody | anti-LIPA antibody

LIPA antibody - N-terminal region

Gene Names
LIPA; LAL; CESD
Reactivity
Cow, Horse, Human, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LIPA; Polyclonal Antibody; LIPA antibody - N-terminal region; anti-LIPA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLAD
Sequence Length
399
Applicable Applications for anti-LIPA antibody
Western Blot (WB)
Homology
Cow: 93%; Horse: 86%; Human: 100%; Pig: 100%; Rabbit: 93%; Rat: 86%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LIPA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LIPASample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: LIPASample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-LIPA AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellLIPA is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-LIPA AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellLIPA is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-LIPA antibody
This is a rabbit polyclonal antibody against LIPA. It was validated on Western Blot

Target Description: This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
lysosomal acid lipase/cholesteryl ester hydrolase isoform 1
NCBI Official Synonym Full Names
lipase A, lysosomal acid type
NCBI Official Symbol
LIPA
NCBI Official Synonym Symbols
LAL; CESD
NCBI Protein Information
lysosomal acid lipase/cholesteryl ester hydrolase
UniProt Protein Name
Lysosomal acid lipase/cholesteryl ester hydrolase
Protein Family
UniProt Gene Name
LIPA
UniProt Synonym Gene Names
Acid cholesteryl ester hydrolase; LAL
UniProt Entry Name
LICH_HUMAN

NCBI Description

This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2014]

Uniprot Description

LIPA: Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor- mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation. Defects in LIPA are the cause of Wolman disease (WOD). WOD is a severe manifestation of LIPA deficiency, leading to the accumulation of cholesteryl esters and triglycerides in most tissues of the body. WOD occurs in infancy and is nearly always fatal before the age of 1 year. Defects in LIPA are the cause of cholesteryl ester storage disease (CESD). CESD is a mild manifestation of LIPA deficiency, leading to the accumulation of cholesteryl esters and triglycerides in most tissues of the body. It is characterized by late-onset. Belongs to the AB hydrolase superfamily. Lipase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - steroid biosynthesis; Hydrolase; EC 3.1.1.13

Chromosomal Location of Human Ortholog: 10q23.2-q23.3

Cellular Component: lysosome

Molecular Function: sterol esterase activity; lipase activity

Biological Process: cell proliferation; homeostasis of number of cells within a tissue; tissue remodeling; cell morphogenesis; cytokine production; inflammatory response; lipid catabolic process; lung development

Disease: Lysosomal Acid Lipase Deficiency

Research Articles on LIPA

Similar Products

Product Notes

The LIPA lipa (Catalog #AAA3215081) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LIPA antibody - N-terminal region reacts with Cow, Horse, Human, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's LIPA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LIPA lipa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SYWGFPSEEY LVETEDGYIL CLNRIPHGRK NHSDKGPKPV VFLQHGLLAD. It is sometimes possible for the material contained within the vial of "LIPA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.