Western Blot (WB)
(Host: RabbitTarget Name: LINGO1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human LINGO1 Polyclonal Antibody | anti-LINGO1 antibody
LINGO1 Antibody - middle region
Gene Names
LINGO1; LERN1; MRT64; LRRN6A; UNQ201
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
LINGO1; Polyclonal Antibody; LINGO1 Antibody - middle region; anti-LINGO1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGE
Sequence Length
614
Applicable Applications for anti-LINGO1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LINGO1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: LINGO1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: LINGO1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-LINGO1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67 kDa
NCBI Official Full Name
leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 isoform b
NCBI Official Synonym Full Names
leucine rich repeat and Ig domain containing 1
NCBI Official Symbol
LINGO1
NCBI Official Synonym Symbols
LERN1; MRT64; LRRN6A; UNQ201
NCBI Protein Information
leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1
UniProt Protein Name
Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1
Protein Family
UniProt Gene Name
LINGO1
UniProt Synonym Gene Names
LERN1; LRRN6A
UniProt Entry Name
LIGO1_HUMAN
Uniprot Description
LINGO1: Functional component of the Nogo receptor signaling complex (RTN4R/NGFR) in RhoA activation responsible for some inhibition of axonal regeneration by myelin-associated factors. Is also an important negative regulator of oligodentrocyte differentiation and axonal myelination. Acts in conjunction with RTN4 and RTN4R in regulating neuronal precursor cell motility during cortical development. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 15q24.3
Cellular Component: plasma membrane
Molecular Function: epidermal growth factor receptor binding; protein binding
Biological Process: axonogenesis; negative regulation of axonogenesis; signal transduction
Research Articles on LINGO1
Similar Products
Product Notes
The LINGO1 lingo1 (Catalog #AAA3221147) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LINGO1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LINGO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LINGO1 lingo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VQDNGTYLCI AANAGGNDSM PAHLHVRSYS PDWPHQPNKT FAFISNQPGE. It is sometimes possible for the material contained within the vial of "LINGO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
