Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-LILRB3 Polyclonal Antibody)

Rabbit anti-Human LILRB3 Polyclonal Antibody | anti-LILRB3 antibody

LILRB3 Polyclonal Antibody

Gene Names
LILRB3; HL9; ILT5; LIR3; PIRB; CD85A; ILT-5; LIR-3; PIR-B; LILRA6
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
LILRB3; Polyclonal Antibody; LILRB3 Polyclonal Antibody; CD85A; HL9; ILT-5; ILT5; LILRA6; LIR-3; LIR3; PIR-B; PIRB; leukocyte immunoglobulin like receptor B3; anti-LILRB3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.91 mg/ml (varies by lot)
Sequence Length
632
Applicable Applications for anti-LILRB3 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 400-500 of human LILRB3 (NP_001307889.1).
Immunogen Sequence
RSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPGGPEDQPLNPPGSGPQNGLGRYLEVLIGVSVAFVLLLFLLLFLLLLRQRHSKHRTSDQRKTDFQ
Positive Samples
Jurkat
Cellular Location
Cell Membrane, Single-Pass Type I Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-LILRB3 Polyclonal Antibody)

Western Blot (WB) (Western blot-LILRB3 Polyclonal Antibody)
Related Product Information for anti-LILRB3 antibody
This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 69kDa; 71kDa
Observed: 69kDa
NCBI Official Full Name
leukocyte immunoglobulin-like receptor subfamily B member 3 isoform 1
NCBI Official Synonym Full Names
leukocyte immunoglobulin like receptor B3
NCBI Official Symbol
LILRB3
NCBI Official Synonym Symbols
HL9; ILT5; LIR3; PIRB; CD85A; ILT-5; LIR-3; PIR-B; LILRA6
NCBI Protein Information
leukocyte immunoglobulin-like receptor subfamily B member 3
UniProt Protein Name
Leukocyte immunoglobulin-like receptor subfamily B member 3
UniProt Gene Name
LILRB3
UniProt Synonym Gene Names
ILT5; LIR3; LIR-3; Leukocyte immunoglobulin-like receptor 3; ILT-5
UniProt Entry Name
LIRB3_HUMAN

NCBI Description

This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

LILRB3: May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B- cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: integral to plasma membrane

Molecular Function: protein binding; receptor activity; transmembrane receptor activity

Biological Process: adaptive immune response; cell surface receptor linked signal transduction; defense response; negative regulation of osteoclast differentiation

Research Articles on LILRB3

Similar Products

Product Notes

The LILRB3 lilrb3 (Catalog #AAA9140717) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LILRB3 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LILRB3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the LILRB3 lilrb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LILRB3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.