Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Ligatin antibody (MBS5300623) used at 1 ug/ml to detect target protein.)

Rabbit Ligatin Polyclonal Antibody | anti-EIF2D antibody

Ligatin antibody

Applications
Western Blot
Purity
Affinity purified
Synonyms
Ligatin; Polyclonal Antibody; Ligatin antibody; Polyclonal Ligatin; Anti-Ligatin; LGTN; HCA56; anti-EIF2D antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Ligatin antibody was raised against the middle region of LGTN
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LGTN antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
75
Applicable Applications for anti-EIF2D antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
LGTN is a protein receptor that localizes phosphoglycoproteins within endosomes and at the cell periphery. This trafficking receptor for phosphoglycoproteins may play a role in neuroplasticity by modulating cell-cell interactions, intracellular adhesion, and protein binding at membrane surfaces. In hippocampal neurons, long-lasting down-regulation of ligatin mRNA levels occurs via post-transcriptional RNA processing following glutamate receptor activation. This protein contains single PUA and SUI1 domains and these domains may function in RNA binding and translation initiation, respectively.
Cross-Reactivity
Human
Immunogen
Ligatin antibody was raised using the middle region of LGTN corresponding to a region with amino acids KVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQ
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Ligatin antibody (MBS5300623) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Ligatin antibody (MBS5300623) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-EIF2D antibody
Rabbit polyclonal Ligatin antibody raised against the middle region of LGTN
Product Categories/Family for anti-EIF2D antibody

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
65 kDa (MW of target protein)
NCBI Official Full Name
ligatin, partial
UniProt Protein Name
Eukaryotic translation initiation factor 2D
UniProt Gene Name
EIF2D
UniProt Synonym Gene Names
HCA56; LGTN; eIF2d
UniProt Entry Name
EIF2D_HUMAN

Uniprot Description

Ligatin: Translation initiation factor that is able to deliver tRNA to the P-site of the eukaryotic ribosome in a GTP-independent manner. The binding of Met-tRNA(I) occurs after the AUG codon finds its position in the P-site of 40S ribosomes, the situation that takes place during initiation complex formation on some specific RNAs. Its activity in tRNA binding with 40S subunits does not require the presence of the aminoacyl moiety. Possesses the unique ability to deliver non-Met (elongator) tRNAs into the P- site of the 40S subunit. In addition to its role in initiation, can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits. Belongs to the eIF2D family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: translation initiation factor activity; receptor activity

Biological Process: intracellular protein transport; ribosome disassembly; formation of translation preinitiation complex

Similar Products

Product Notes

The Ligatin eif2d (Catalog #AAA5300623) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Ligatin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the Ligatin eif2d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Ligatin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.