Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CYP2A6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: COLO205 cell lysate)

Rabbit anti-Horse, Human CYP2A6 Polyclonal Antibody | anti-CYP2A6 antibody

CYP2A6 antibody - C-terminal region

Gene Names
CYP2A6; CPA6; CYP2A; CYP2A3; P450PB; CYPIIA6; P450C2A
Reactivity
Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CYP2A6; Polyclonal Antibody; CYP2A6 antibody - C-terminal region; anti-CYP2A6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKH
Sequence Length
494
Applicable Applications for anti-CYP2A6 antibody
Western Blot (WB)
Homology
Horse: 83%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CYP2A6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CYP2A6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: COLO205 cell lysate)

Western Blot (WB) (WB Suggested Anti-CYP2A6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: COLO205 cell lysate)
Related Product Information for anti-CYP2A6 antibody
This is a rabbit polyclonal antibody against CYP2A6. It was validated on Western Blot

Target Description: CYP2A6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to hydroxylate coumarin, and also metabolizes nicotine, aflatoxin B1, nitrosamines, and some pharmaceuticals. Individuals with certain allelic variants are said to have a poor metabolizer phenotype, meaning they do not efficiently metabolize coumarin or nicotine. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. The gene was formerly referred to as CYP2A3; however, it has been renamed CYP2A6.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
cytochrome P450 2A6
NCBI Official Synonym Full Names
cytochrome P450 family 2 subfamily A member 6
NCBI Official Symbol
CYP2A6
NCBI Official Synonym Symbols
CPA6; CYP2A; CYP2A3; P450PB; CYPIIA6; P450C2A
NCBI Protein Information
cytochrome P450 2A6
UniProt Protein Name
Cytochrome P450 2A6
Protein Family
UniProt Gene Name
CYP2A6
UniProt Synonym Gene Names
CYP2A3
UniProt Entry Name
CP2A6_HUMAN

NCBI Description

This gene, CYP2A6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to hydroxylate coumarin, and also metabolizes nicotine, aflatoxin B1, nitrosamines, and some pharmaceuticals. Individuals with certain allelic variants are said to have a poor metabolizer phenotype, meaning they do not efficiently metabolize coumarin or nicotine. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. The gene was formerly referred to as CYP2A3; however, it has been renamed CYP2A6. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP2A6: Exhibits a high coumarin 7-hydroxylase activity. Can act in the hydroxylation of the anti-cancer drugs cyclophosphamide and ifosphamide. Competent in the metabolic activation of aflatoxin B1. Constitutes the major nicotine C-oxidase. Acts as a 1,4- cineole 2-exo-monooxygenase. Possesses low phenacetin O- deethylation activity. Belongs to the cytochrome P450 family.

Protein type: Xenobiotic Metabolism - drug metabolism - other enzymes; EC 1.14.14.1; Oxidoreductase; Secondary Metabolites Metabolism - caffeine; Cofactor and Vitamin Metabolism - retinol; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle; cytoplasmic microtubule

Molecular Function: coumarin 7-hydroxylase activity; enzyme binding; iron ion binding; heme binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen; arachidonic acid epoxygenase activity; steroid hydroxylase activity; oxygen binding

Biological Process: steroid metabolic process; coumarin metabolic process; xenobiotic metabolic process; coumarin catabolic process; exogenous drug catabolic process; epoxygenase P450 pathway; drug metabolic process

Disease: Tobacco Addiction, Susceptibility To; Lung Cancer; Coumarin Resistance

Research Articles on CYP2A6

Similar Products

Product Notes

The CYP2A6 cyp2a6 (Catalog #AAA3214668) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP2A6 antibody - C-terminal region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP2A6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYP2A6 cyp2a6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AFVPFSIGKR NCFGEGLARM ELFLFFTTVM QNFRLKSSQS PKDIDVSPKH. It is sometimes possible for the material contained within the vial of "CYP2A6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.