Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Heart )

Rabbit LHX3 Polyclonal Antibody | anti-LHX3 antibody

LHX3 antibody - middle region

Gene Names
LHX3; LIM3; CPHD3; M2-LHX3
Reactivity
Tested: Human
Predicted: Human; Cow; Dog; Guinea Pig; Horse; Mouse; Rat; Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
LHX3; Polyclonal Antibody; LHX3 antibody - middle region; anti-LHX3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested: Human
Predicted: Human; Cow; Dog; Guinea Pig; Horse; Mouse; Rat; Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEV
Sequence Length
402
Applicable Applications for anti-LHX3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 87%; Human: 100%; Mouse: 93%; Rat: 100%; Zebrafish: 80%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LHX3
Protein Size (#AA)
402 amino acids
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Heart )

Immunohistochemistry (IHC) (Human Heart )

Immunohistochemistry (IHC)

(Human Lung )

Immunohistochemistry (IHC) (Human Lung )

Western Blot (WB)

(WB Suggested Anti-LHX3 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-LHX3 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-LHX3 antibody
This is a rabbit polyclonal antibody against LHX3. It was validated on Western Blot and immunohistochemistry

Target Description: LHX3 encodes a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
LIM/homeobox protein Lhx3 isoform b
NCBI Official Synonym Full Names
LIM homeobox 3
NCBI Official Symbol
LHX3
NCBI Official Synonym Symbols
LIM3; CPHD3; M2-LHX3
NCBI Protein Information
LIM/homeobox protein Lhx3
UniProt Protein Name
LIM/homeobox protein Lhx3
Protein Family
UniProt Gene Name
LHX3
UniProt Synonym Gene Names
LIM homeobox protein 3
UniProt Entry Name
LHX3_HUMAN

NCBI Description

This gene encodes a member of a large family of proteins which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene cause combined pituitary hormone deficiency 3. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]

Uniprot Description

LHX3: Acts as a transcriptional activator. Binds to and activates the promoter of the alpha-glycoprotein gene, and synergistically enhances transcription from the prolactin promoter in cooperation with Pit-1. Defects in LHX3 are the cause of pituitary hormone deficiency combined type 3 (CPHD3); also known as combined pituitary hormone deficiency with rigid cervical spine or sensorineural deafness with pituitary dwarfism. CPHD is characterized by a complete deficit in all but one (adrenocorticotropin) anterior pituitary hormone and a rigid cervical spine leading to limited head rotation. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 9q34.3

Cellular Component: transcription factor complex; nucleus

Molecular Function: zinc ion binding; sequence-specific DNA binding

Biological Process: transcription from RNA polymerase II promoter; organ morphogenesis; pituitary gland development; positive regulation of transcription, DNA-dependent; spinal cord motor neuron cell fate specification; spinal cord association neuron differentiation; motor axon guidance; positive regulation of transcription from RNA polymerase II promoter; medial motor column neuron differentiation; ventral spinal cord interneuron specification; inner ear development; negative regulation of apoptosis; placenta development; lung development

Disease: Pituitary Hormone Deficiency, Combined, 3

Research Articles on LHX3

Similar Products

Product Notes

The LHX3 lhx3 (Catalog #AAA3201649) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LHX3 antibody - middle region reacts with Tested: Human Predicted: Human; Cow; Dog; Guinea Pig; Horse; Mouse; Rat; Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LHX3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the LHX3 lhx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QNRRAKEKRL KKDAGRQRWG QYFRNMKRSR GGSKSDKDSV QEGQDSDAEV. It is sometimes possible for the material contained within the vial of "LHX3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.