Immunohistochemistry (IHC)
(Anti-LGR5 antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.)
Rabbit LGR5 Polyclonal Antibody | anti-LGR5 antibody
LGR5 Antibody-middle region
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry
Purity
Affinity Purified
Synonyms
LGR5; Polyclonal Antibody; LGR5 Antibody-middle region; Leucine-rich repeat-containing G-protein coupled receptor 5; Znrf3; FEX; HG38; GPR49; GPR67; GRP49; anti-LGR5 antibody
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG
Applicable Applications for anti-LGR5 antibody
Immunohistochemistry (IHC)
Protein Size
907 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the following sequence KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG
Predicted Homology Based on Immunogen Sequence
Cow: 93%; Horse: 92%; Human: 100%; Mouse: 93%; Pig: 77%; Rabbit: 93%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Anti-LGR5 antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.)
Immunohistochemistry (IHC)
(Anti-LGR5 antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.)
Western Blot (WB)
(Host: RabbitTarget Name: LGR5Sample Tissue: Human Liver TumorAntibody Dilution: 0.5ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: LGR5Sample Tissue: Human Liver TumorAntibody Dilution: 0.5ug/ml)
NCBI and Uniprot Product Information
NCBI GeneID
Molecular Weight
100kDa
UniProt Protein Name
Leucine-rich repeat-containing G-protein coupled receptor 5
Protein Family
UniProt Gene Name
LGR5
UniProt Synonym Gene Names
GPR49; GPR67
Uniprot Description
Receptor for R-spondins that potentiates the canonical Wnt signaling pathway and acts as a stem cell marker of the intestinal epithelium and the hair follicle. Upon binding to R-spondins (RSPO1, RSPO2, RSPO3 or RSPO4), associates with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. In contrast to classical G-protein coupled receptors, does not activate heterotrimeric G-proteins to transduce the signal. Involved in the development and/or maintenance of the adult intestinal stem cells during postembryonic development.
Similar Products
Product Notes
The LGR5 lgr5 (Catalog #AAA3249637) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LGR5 Antibody-middle region reacts with Cow, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LGR5 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the LGR5 lgr5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KKDAGMFQAQ DERDLEDFLL DFEEDLKALH SVQCSPSPGP FKPCEHLLDG. It is sometimes possible for the material contained within the vial of "LGR5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
