Rabbit anti-Mouse LEP Polyclonal Antibody | anti-LEP antibody

LEP Antibody - middle region

Cat. Num. AAA3223582

• Gene Names: Lep; ob; obese
• Reactivity: Mouse
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: LEP; Polyclonal Antibody; LEP Antibody - middle region; anti-LEP antibody

• Host: Rabbit
• Reactivity: Mouse
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: WLWSYLSYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGL
• Sequence Length: 167

• Applicable Applications for anti-LEP antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse LEP
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LEPSample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-LEP antibody

Key player in the regulation of energy balance and body weight control. Once released into the circulation, has central and peripheral effects by binding LEPR, found in many tissues, which results in the activation of several major signaling pathways. In the hypothalamus, acts as an appetite-regulating factor that induces a decrease in food intake and an increase in energy consumption by inducing anorexinogenic factors and suppressing orexigenic neuropeptides, also regulates bone mass and secretion of hypothalamo-pituitary-adrenal hormones. In the periphery, increases basal metabolism, influences. In the arcuate nucleus of the hypothalamus, activates by depolarization POMC neurons inducing FOS and SOCS3 expression to release anorexigenic peptides and inhibits by hyperpolarization NPY neurons inducing SOCS3 with a consequent reduction on release of orexigenic peptides (By similarity) (PubMed:20620997, PubMed:11373681). In addition to its known satiety inducing effect, has a modulatory role in nutrient absorption. In the intestine, reduces glucose absorption by enterocytes by activating PKC and leading to a sequential activation of p38, PI3K and ERK signaling pathways which exerts an inhibitory effect on glucose absorption. Acts as a growth factor on certain tissues, through the activation of different signaling pathways increases expression of genes involved in cell cycle regulation such as CCND1, via JAK2-STAT3 pathway, or VEGFA, via MAPK1/3 and PI3K-AKT1 pathways (By similarity). May also play an apoptotic role via JAK2-STAT3 pathway and up-regulation of BIRC5 expression (By similarity). Pro-angiogenic, has mitogenic activity on vascular endothelial cells and plays a role in matrix remodeling by regulating the expression of matrix metalloproteinases (MMPs) and tissue inhibitors of metalloproteinases (TIMPs). In innate immunity, modulates the activity and function of neutrophils by increasing chemotaxis and the secretion of oxygen radicals. Increases phagocytosis by macrophages and enhances secretion of pro-inflammatory mediators. Increases cytotoxic ability of NK cells (Probable). Plays a pro-inflammatory role, in synergy with IL1B, by inducing NOS2 wich promotes the production of IL6, IL8 and Prostaglandin E2, through a signaling pathway that involves JAK2, PI3K, MAP2K1/MEK1 and MAPK14/p38. In adaptive immunity, promotes the switch of memory T-cells towards T helper-1 cell immune responses (By similarity). Increases CD4+CD25- T cells proliferation and reduces autophagy during TCR (T cell receptor) stimulation, through MTOR signaling pathway activation and BCL2 up-regulation.

Product Categories/Family for anti-LEP antibody

Polyclonal; Neurobiology; Growth Factors & Hormones; Developmental Biology; Immunology; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 6678678
• NCBI GeneID: 16846
• NCBI Accession #: NP_032519.1
• NCBI GenBank Nucleotide #: NM_008493.3
• UniProt Accession #: P41160
• Molecular Weight: 18 kDa
• NCBI Official Full Name: leptin
• NCBI Official Synonym Full Names: leptin
• NCBI Official Symbol: Lep
• NCBI Official Synonym Symbols: ob; obese
• NCBI Protein Information: leptin
• UniProt Protein Name: Leptin
• Protein Family: Leptin
• UniProt Gene Name: Lep
• UniProt Synonym Gene Names: Ob
• UniProt Entry Name: LEP_MOUSE

Uniprot Description

leptin: May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass. Defects in LEP may be a cause of obesity (OBESITY). It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat. Belongs to the leptin family.

Protein type: Cell development/differentiation; Secreted; Secreted, signal peptide; Hormone

Cellular Component: extracellular space; cell; cytoplasm; extracellular region; intracellular

Molecular Function: protein binding; growth factor activity; peptide hormone receptor binding; hormone activity

Biological Process: response to dietary excess; positive regulation of myeloid cell differentiation; regulation of fat cell differentiation; positive regulation of JAK-STAT cascade; regulation of steroid biosynthetic process; negative regulation of transcription from RNA polymerase II promoter; signal transduction; glucose homeostasis; negative regulation of metabolic process; negative regulation of appetite; response to insulin stimulus; positive regulation of tyrosine phosphorylation of Stat3 protein; regulation of cholesterol absorption; positive regulation of MAPKKK cascade; regulation of blood pressure; positive regulation of cell proliferation; positive regulation of ion transport; regulation of metabolic process; central nervous system neuron development; placenta development; cholesterol metabolic process; positive regulation of developmental growth; regulation of protein amino acid phosphorylation; eating behavior; bile acid metabolic process; glucose metabolic process; adult feeding behavior; fatty acid catabolic process; ovulation from ovarian follicle; leptin-mediated signaling pathway; negative regulation of vasoconstriction; tyrosine phosphorylation of STAT protein; fatty acid beta-oxidation; positive regulation of protein import into nucleus; glycerol biosynthetic process; insulin secretion; energy reserve metabolic process; hormone metabolic process; regulation of gluconeogenesis; lipid metabolic process; positive regulation of insulin receptor signaling pathway; leukocyte tethering or rolling; regulation of insulin secretion; negative regulation of apoptosis