Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LENG4 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Rabbit LENG4 Polyclonal Antibody | anti-MBOAT7 antibody

LENG4 antibody - C-terminal region

Gene Names
MBOAT7; BB1; LRC4; LENG4; LPIAT; LPLAT; MBOA7; MRT57; OACT7; hMBOA-7
Reactivity
Dog, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
LENG4; Polyclonal Antibody; LENG4 antibody - C-terminal region; anti-MBOAT7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW
Sequence Length
472
Applicable Applications for anti-MBOAT7 antibody
Western Blot (WB)
Homology
Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human LENG4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LENG4 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-LENG4 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-MBOAT7 antibody
This is a rabbit polyclonal antibody against LENG4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function remains unknown.
Product Categories/Family for anti-MBOAT7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
lysophospholipid acyltransferase 7 isoform 1
NCBI Official Synonym Full Names
membrane bound O-acyltransferase domain containing 7
NCBI Official Symbol
MBOAT7
NCBI Official Synonym Symbols
BB1; LRC4; LENG4; LPIAT; LPLAT; MBOA7; MRT57; OACT7; hMBOA-7
NCBI Protein Information
lysophospholipid acyltransferase 7
UniProt Protein Name
Lysophospholipid acyltransferase 7
UniProt Gene Name
MBOAT7
UniProt Synonym Gene Names
BB1; LENG4; OACT7; LPLAT 7; LPIAT; Lyso-PI acyltransferase; O-acyltransferase domain-containing protein 7; h-mboa-7
UniProt Entry Name
MBOA7_HUMAN

NCBI Description

This gene encodes a member of the membrane-bound O-acyltransferases family of integral membrane proteins that have acyltransferase activity. The encoded protein is a lysophosphatidylinositol acyltransferase that has specificity for arachidonoyl-CoA as an acyl donor. This protein is involved in the reacylation of phospholipids as part of the phospholipid remodeling pathway known as the Land cycle. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2009]

Uniprot Description

Function: Acyltransferase which mediates the conversion of lysophosphatidylinositol (1-acylglycerophosphatidylinositol or LPI) into phosphatidylinositol (1,2-diacyl-sn-glycero-3-phosphoinositol or PI) (LPIAT activity). Prefers arachidonoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle. Ref.1 Ref.7

Catalytic activity: Acyl-CoA + 1-acyl-sn-glycero-3-phosphatidylinositol = CoA + 1,2-diacyl-sn-glycero-3-phosphatidylinositol. Ref.1Acyl-[acyl-carrier-protein] + 1-acyl-sn-glycerol 3-phosphate = [acyl-carrier-protein] + 1,2-diacyl-sn-glycerol 3-phosphate. Ref.1

Enzyme regulation: Activity is inhibited by thimerosal.

Pathway: Lipid metabolism; phospholipid metabolism. Ref.1

Subcellular location: Membrane; Multi-pass membrane protein

Potential.

Tissue specificity: Overexpressed in metastatic breast and bladder carcinomas relative to normal breast epithelium and urothelium. Ref.7

Sequence similarities: Belongs to the membrane-bound acyltransferase family.

Sequence caution: The sequence AAB37433.1 differs from that shown. Reason: Frameshift at positions 63, 93, 144 and 186.

Research Articles on MBOAT7

Similar Products

Product Notes

The MBOAT7 mboat7 (Catalog #AAA3209648) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LENG4 antibody - C-terminal region reacts with Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LENG4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MBOAT7 mboat7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSAYWHGLHP GYYLSFLTIP LCLAAEGRLE SALRGRLSPG GQKAWDWVHW. It is sometimes possible for the material contained within the vial of "LENG4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.