Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of LEFTY2 expression in transfected 293T cell line by LEFTY2 polyclonal antibody. Lane 1: LEFTY2 transfected lysate (40.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human LEFTYA Polyclonal Antibody | anti-LEFTYA antibody

LEFTYA (Left-right Determination Factor 2, Protein Lefty-2, Left-right Determination Factor A, Protein Lefty-A, Transforming Growth Factor beta-4, TGF-beta-4, Endometrial Bleeding-associated Factor, EBAF, LEFTA, LEFTY2, TGFB4, PSEC0024, MGC46222) (Biotin)

Gene Names
LEFTY2; EBAF; LEFTA; TGFB4; LEFTYA
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LEFTYA; Polyclonal Antibody; LEFTYA (Left-right Determination Factor 2; Protein Lefty-2; Left-right Determination Factor A; Protein Lefty-A; Transforming Growth Factor beta-4; TGF-beta-4; Endometrial Bleeding-associated Factor; EBAF; LEFTA; LEFTY2; TGFB4; PSEC0024; MGC46222) (Biotin); anti-LEFTYA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LEFTY2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-LEFTYA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human LEFTY2, aa1-366 (NP_003231.2).
Immunogen Sequence
MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LEFTY2 expression in transfected 293T cell line by LEFTY2 polyclonal antibody. Lane 1: LEFTY2 transfected lysate (40.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LEFTY2 expression in transfected 293T cell line by LEFTY2 polyclonal antibody. Lane 1: LEFTY2 transfected lysate (40.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-LEFTYA antibody
During vertebrate embryogenesis, a left-right axis is established. Secreted growth factors of the TGF-beta family, including gene products derived from nodal, lefty-1 and lefty-2, play crucial roles in establishing left-right asymmetries. TGF-beta (Transforming growth factor-beta) is a pleiotropic cytokine that regulates growth and differentiation of diverse types of cells. TGF-beta actions are directed by ligand-induced activation of TGF-beta receptors. Complexes formed move into the nucleus, where they act as components of a transcriptional complex. Lefty, a novel member of the TGF-beta superfamily, inhibits TGF-beta signaling. Lefty acts to inhibit phosphorylation of Smad2 following activation of the TGF-beta receptor. Lefty also inhibits events downstream from R-Smad phosphorylation. Lefty provides a repressed state of TGF-beta-responsive genes. The Lefty family is comprised of Lefty 1 and Lefty 2 in mouse, and Lefty A and Lefty B in humans. Members of the TGF-beta superfamily require processing for their activation. Cleavage is therefore an essential step for Lefty activation. Lefty is synthesized as a large inactive precursor (42kD) that must be endoproteolytically processed to release the bioactive polypeptide (28kD and 34kD forms). The 28kD form induces MAPK activity.
Product Categories/Family for anti-LEFTYA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,093 Da
NCBI Official Full Name
left-right determination factor 2 isoform 1 preproprotein
NCBI Official Synonym Full Names
left-right determination factor 2
NCBI Official Symbol
LEFTY2
NCBI Official Synonym Symbols
EBAF; LEFTA; TGFB4; LEFTYA
NCBI Protein Information
left-right determination factor 2; TGF-beta-4; protein lefty-2; protein lefty-A; left-right determination factor A; transforming growth factor beta-4; endometrial bleeding-associated factor
UniProt Protein Name
Left-right determination factor 2
UniProt Gene Name
LEFTY2
UniProt Synonym Gene Names
EBAF; LEFTA; LEFTYA; TGFB4; TGF-beta-4
UniProt Entry Name
LFTY2_HUMAN

NCBI Description

This gene encodes a member of the TGF-beta family of proteins. The encoded protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in this gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of this gene in the endometrium. Alternative processing of this protein can yield three different products. This gene is closely linked to both a related family member and a related pseudogene. Alternate splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2010]

Uniprot Description

LEFTY2: Required for left-right (L-R) asymmetry determination of organ systems in mammals. May play a role in endometrial bleeding. Defects in LEFTY2 are the cause of left-right axis malformations (LRAM). The defect includes left pulmonary isomerism, with cardiac anomalies characterized by complete atrioventricular canal defect and hypoplastic left ventricle, and interrupted inferior vena cava. Belongs to the TGF-beta family.

Protein type: Ligand, receptor tyrosine kinase; Secreted, signal peptide; Cytokine; Secreted

Chromosomal Location of Human Ortholog: 1q42.1

Cellular Component: extracellular matrix; extracellular space; extracellular region

Molecular Function: growth factor activity; cytokine activity; transforming growth factor beta receptor binding

Biological Process: regulation of apoptosis; platelet activation; platelet degranulation; regulation of MAPKKK cascade; transforming growth factor beta receptor signaling pathway; multicellular organismal development; cell growth; blood coagulation; cell development

Research Articles on LEFTYA

Similar Products

Product Notes

The LEFTYA lefty2 (Catalog #AAA6384160) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LEFTYA (Left-right Determination Factor 2, Protein Lefty-2, Left-right Determination Factor A, Protein Lefty-A, Transforming Growth Factor beta-4, TGF-beta-4, Endometrial Bleeding-associated Factor, EBAF, LEFTA, LEFTY2, TGFB4, PSEC0024, MGC46222) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LEFTYA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LEFTYA lefty2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LEFTYA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.