Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: LAMTOR3Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/mlLAMTOR3 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit LAMTOR3 Polyclonal Antibody | anti-LAMTOR3 antibody

LAMTOR3 Antibody - N-terminal region

Gene Names
LAMTOR3; MP1; MAPBP; MAPKSP1; PRO0633; MAP2K1IP1; Ragulator3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LAMTOR3; Polyclonal Antibody; LAMTOR3 Antibody - N-terminal region; anti-LAMTOR3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSK
Sequence Length
124
Applicable Applications for anti-LAMTOR3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LAMTOR3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LAMTOR3Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/mlLAMTOR3 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (Host: RabbitTarget Name: LAMTOR3Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/mlLAMTOR3 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-LAMTOR3 antibody
This is a rabbit polyclonal antibody against LAMTOR3. It was validated on Western Blot

Target Description: This gene encodes a scaffold protein that functions in the extracellular signal-regulated kinase (ERK) cascade. The protein is localized to late endosomes by the mitogen-activated protein-binding protein-interacting protein, and binds specifically to MAP kinase kinase MAP2K1/MEK1, MAP kinase MAPK3/ERK1, and MAP kinase MAPK1/ERK2. Studies of the orthologous gene in mouse indicate that it regulates late endosomal traffic and cell proliferation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 13.
Product Categories/Family for anti-LAMTOR3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
ragulator complex protein LAMTOR3 isoform 1
NCBI Official Synonym Full Names
late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
NCBI Official Symbol
LAMTOR3
NCBI Official Synonym Symbols
MP1; MAPBP; MAPKSP1; PRO0633; MAP2K1IP1; Ragulator3
NCBI Protein Information
ragulator complex protein LAMTOR3
UniProt Protein Name
Ragulator complex protein LAMTOR3
Protein Family
UniProt Gene Name
LAMTOR3
UniProt Synonym Gene Names
MAP2K1IP1; MAPKSP1; Mp1
UniProt Entry Name
LTOR3_HUMAN

NCBI Description

This gene encodes a scaffold protein that functions in the extracellular signal-regulated kinase (ERK) cascade. The protein is localized to late endosomes by the mitogen-activated protein-binding protein-interacting protein, and binds specifically to MAP kinase kinase MAP2K1/MEK1, MAP kinase MAPK3/ERK1, and MAP kinase MAPK1/ERK2. Studies of the orthologous gene in mouse indicate that it regulates late endosomal traffic and cell proliferation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 13. [provided by RefSeq, Aug 2011]

Uniprot Description

LAMTOR3: Regulator of the TOR pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids. As part of the Ragulator complex, recruits the Rag GTPases and the mTORC1 complex to lysosomes, a key step in activation of the TOR signaling cascade by amino acids. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2. Interacts with MAP2K1/MEK1 and MAPK2. Interacts with MORG1. Part of the Ragulator complex composed of LAMTOR1, LAMTOR2 and LAMTOR3. Interacts with LAMTOR1; the interaction is direct. Belongs to the LAMTOR3 family.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 4q23

Cellular Component: focal adhesion

Molecular Function: protein binding; guanyl-nucleotide exchange factor activity; protein complex scaffold

Biological Process: positive regulation of TOR signaling pathway; positive regulation of GTPase activity

Research Articles on LAMTOR3

Similar Products

Product Notes

The LAMTOR3 lamtor3 (Catalog #AAA3214743) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LAMTOR3 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LAMTOR3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LAMTOR3 lamtor3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LPSVEGLHAI VVSDRDGVPV IKVANDNAPE HALRPGFLST FALATDQGSK. It is sometimes possible for the material contained within the vial of "LAMTOR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.