Mouse anti-Human MAPKSP1 Monoclonal Antibody | anti-MAPKSP1 antibody

MAPKSP1 (LAMTOR3, MAP2K1IP1, MAPKSP1, Ragulator Complex Protein LAMTOR3, Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 3, MEK-binding Partner 1, Mp1, Mitogen-activated Protein Kinase Kinase 1-interacting Protein 1, Mitogen-activated Protein

Cat. Num. AAA6153430

• Gene Names: LAMTOR3; MP1; MAPBP; MAPKSP1; PRO0633; MAP2K1IP1; Ragulator3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MAPKSP1; Monoclonal Antibody; MAPKSP1 (LAMTOR3; MAP2K1IP1; Ragulator Complex Protein LAMTOR3; Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 3; MEK-binding Partner 1; Mp1; Mitogen-activated Protein Kinase Kinase 1-interacting Protein 1; Mitogen-activated Protein; anti-MAPKSP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A4
• Specificity: Recognizes human MAPKSP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-MAPKSP1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-88 from MAPKSP1 (NP_068805) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLP*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.31kD).)

Western Blot (WB)

(Western Blot analysis of MAPKSP1 expression in transfected 293T cell line by MAPKSP1 monoclonal antibody Lane 1: MAPKSP1 transfected lysate (13.623kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-MAPKSP1 antibody

MAPKSP1 (Mitogen-activated protein kinase scaffold protein 1) is a scaffold protein that functions in the extracellular signal-regulated kinase (ERK) cascade. The protein is localized to late endosomes by the mitogen-activated protein-binding protein-interacting protein, and binds specifically to MAP kinase kinase MAP2K1/MEK1, MAP kinase MAPK3/ERK1, and MAP kinase MAPK1/ERK2.

Product Categories/Family for anti-MAPKSP1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 11496277
• NCBI GeneID: 8649
• NCBI Accession #: NP_068805
• NCBI GenBank Nucleotide #: NM_021970
• UniProt Accession #: Q9UHA4; Q9H364; B2R4A1; J3KMX4
• Molecular Weight: Predicted: 14 kDa; ; Observed: 13 kDa
• NCBI Official Full Name: ragulator complex protein LAMTOR3 isoform 1
• NCBI Official Synonym Full Names: late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
• NCBI Official Symbol: LAMTOR3
• NCBI Official Synonym Symbols: MP1; MAPBP; MAPKSP1; PRO0633; MAP2K1IP1; Ragulator3
• NCBI Protein Information: ragulator complex protein LAMTOR3; MEK binding partner 1; MAPK scaffold protein 1; mitogen-activated protein kinase scaffold protein 1; late endosomal/lysosomal adaptor and MAPK and MTOR activator 3; mitogen-activated protein kinase kinase 1 interacting p
• UniProt Protein Name: Ragulator complex protein LAMTOR3
• UniProt Gene Name: LAMTOR3
• UniProt Synonym Gene Names: MAP2K1IP1; MAPKSP1; Mp1
• UniProt Entry Name: LTOR3_HUMAN

NCBI Description

This gene encodes a scaffold protein that functions in the extracellular signal-regulated kinase (ERK) cascade. The protein is localized to late endosomes by the mitogen-activated protein-binding protein-interacting protein, and binds specifically to MAP kinase kinase MAP2K1/MEK1, MAP kinase MAPK3/ERK1, and MAP kinase MAPK1/ERK2. Studies of the orthologous gene in mouse indicate that it regulates late endosomal traffic and cell proliferation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 13. [provided by RefSeq, Aug 2011]

Uniprot Description

LAMTOR3: Regulator of the TOR pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids. As part of the Ragulator complex, recruits the Rag GTPases and the mTORC1 complex to lysosomes, a key step in activation of the TOR signaling cascade by amino acids. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2. Interacts with MAP2K1/MEK1 and MAPK2. Interacts with MORG1. Part of the Ragulator complex composed of LAMTOR1, LAMTOR2 and LAMTOR3. Interacts with LAMTOR1; the interaction is direct. Belongs to the LAMTOR3 family.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 4q23

Cellular Component: focal adhesion

Molecular Function: protein binding; guanyl-nucleotide exchange factor activity; protein complex scaffold

Biological Process: positive regulation of TOR signaling pathway; positive regulation of GTPase activity