Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: L2HGDHSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit L2HGDH Polyclonal Antibody | anti-L2HGDH antibody

L2HGDH Antibody - middle region

Gene Names
L2HGDH; L2HGA; C14orf160
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
L2HGDH; Polyclonal Antibody; L2HGDH Antibody - middle region; anti-L2HGDH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAG
Sequence Length
463
Applicable Applications for anti-L2HGDH antibody
Western Blot (WB)
Homology
Cow: 91%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 100%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human L2HGDH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: L2HGDHSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: L2HGDHSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-L2HGDH antibody
This is a rabbit polyclonal antibody against L2HGDH. It was validated on Western Blot

Target Description: This gene encodes L-2-hydroxyglutarate dehydrogenase, a FAD-dependent enzyme that oxidizes L-2-hydroxyglutarate to alpha-ketoglutarate in a variety of mammalian tissues. Mutations in this gene cause L-2-hydroxyglutaric aciduria, a rare autosomal recessive neurometabolic disorder resulting in moderate to severe mental retardation.
Product Categories/Family for anti-L2HGDH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
L-2-hydroxyglutarate dehydrogenase, mitochondrial
NCBI Official Synonym Full Names
L-2-hydroxyglutarate dehydrogenase
NCBI Official Symbol
L2HGDH
NCBI Official Synonym Symbols
L2HGA; C14orf160
NCBI Protein Information
L-2-hydroxyglutarate dehydrogenase, mitochondrial
UniProt Protein Name
L-2-hydroxyglutarate dehydrogenase, mitochondrial
UniProt Gene Name
L2HGDH
UniProt Synonym Gene Names
C14orf160
UniProt Entry Name
L2HDH_HUMAN

NCBI Description

This gene encodes L-2-hydroxyglutarate dehydrogenase, a FAD-dependent enzyme that oxidizes L-2-hydroxyglutarate to alpha-ketoglutarate in a variety of mammalian tissues. Mutations in this gene cause L-2-hydroxyglutaric aciduria, a rare autosomal recessive neurometabolic disorder resulting in moderate to severe cognitive disability. [provided by RefSeq, Jul 2008]

Uniprot Description

Catalytic activity: (S)-2-hydroxyglutarate + acceptor = 2-oxoglutarate + reduced acceptor. Ref.5

Cofactor: FAD. Ref.5

Subcellular location: Mitochondrion Ref.5.

Tissue specificity: Widely expressed. Highly expressed in brain, testis and muscle. Expressed to a lower extent in lymphocytes, fibroblasts, keratinocytes, placenta, bladder, small intestine, liver and bone marrow. Ref.8

Involvement in disease: L-2-hydroxyglutaric aciduria (L2HGA) [MIM:236792]: A rare autosomal recessive disorder clinically characterized by mild psychomotor delay in the first years of life, followed by progressive cerebellar ataxia, dysarthria and moderate to severe mental retardation. Diagnosis is based on the presence of an excess of L-2-hydroxyglutaric acid in urine, blood and cerebrospinal fluid.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.1 Ref.8 Ref.9

Miscellaneous: Was named 'duranin' in honor of Marinus Duran, who first described L-2-hydroxyglutaric aciduria.

Sequence similarities: Belongs to the L2HGDH family.

Biophysicochemical propertiesKinetic parameters:KM=800 µM for L-2-hydroxyglutarate Ref.5

Research Articles on L2HGDH

Similar Products

Product Notes

The L2HGDH l2hgdh (Catalog #AAA3216612) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The L2HGDH Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's L2HGDH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the L2HGDH l2hgdh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSVLTNFEVK GIEMAKESPS RSIDGMQYPI VIKNTKGEEI RCQYVVTCAG. It is sometimes possible for the material contained within the vial of "L2HGDH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.