Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- Ku70 Picoband antibody, MBS178384, Western blottingAll lanes: Anti (MBS178384) at 0.5ug/mlLane 1: A549 Whole Cell Lysate at 40ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: HEPG2 Whole Cell Lysate at 40ugLane 4: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 70KDObserved bind size: 70KD )

anti-Human Ku70 Polyclonal Antibody | anti-Ku70 antibody

Anti-Ku70 Antibody

Gene Names
XRCC6; ML8; KU70; TLAA; CTC75; CTCBF; G22P1
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
Ku70; Polyclonal Antibody; Anti-Ku70 Antibody; X-ray repair cross-complementing protein 6; 5''-deoxyribose-5-phosphate lyase Ku70; 5''-dRP lyase Ku70; 70 kDa subunit of Ku antigen; ATP dependent DNA helicase 2 subunit 1; ATP dependent DNA helicase II 70 kDa subunit; ATP-dependent DNA helicase 2 subunit 1; ATP-dependent DNA helicase II 70 kDa subunit; CTC box binding factor 75 kDa subunit; CTC box-binding factor 75 kDa subunit; CTC75; CTCBF; DNA repair protein XRCC6; G22P1; Ku 70; Ku autoantigen 70kDa; Ku autoantigen p70 subunit; Ku autoantigen; 70kDa; Ku p70; Ku70 DNA binding component of DNA-dependent proteinkinase complex (thyroid autoantigen 70 kDa; Kup70; Lupus Ku autoantigen protein p70; ML8; Thyroid autoantigen 70kD (Ku antigen); Thyroid autoantigen; Thyroid lupus autoantigen; Thyroid lupus autoantigen p70; Thyroid-lupus autoantigen; TLAA; X ray repair complementing defective repair in Chinese hamster cells 6; X-ray repair complementing defective repair in Chinese hamster cells 6; XRCC 6; XRCC6; XRCC6_HUMAN; anti-Ku70 antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
609
Applicable Applications for anti-Ku70 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at C-terminus of human Ku70 (464-496aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD), different from the related mouse sequence by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Ku70 Picoband antibody, MBS178384, Western blottingAll lanes: Anti (MBS178384) at 0.5ug/mlLane 1: A549 Whole Cell Lysate at 40ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: HEPG2 Whole Cell Lysate at 40ugLane 4: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 70KDObserved bind size: 70KD )

Western Blot (WB) (Anti- Ku70 Picoband antibody, MBS178384, Western blottingAll lanes: Anti (MBS178384) at 0.5ug/mlLane 1: A549 Whole Cell Lysate at 40ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: HEPG2 Whole Cell Lysate at 40ugLane 4: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 70KDObserved bind size: 70KD )

Immunohistochemistry (IHC)

(Anti- Ku70 Picoband antibody, MBS178384, IHC(P)IHC(P): Human Tonsil Tissue )

Immunohistochemistry (IHC) (Anti- Ku70 Picoband antibody, MBS178384, IHC(P)IHC(P): Human Tonsil Tissue )
Related Product Information for anti-Ku70 antibody
Description: Rabbit IgG polyclonal antibody for X-ray repair cross-complementing protein 6(XRCC6) detection. Tested with WB, IHC-P in Human.

Background: XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.
References
1. Baumann, P., West, S. C. DNA end-joining catalyzed by human cell-free extracts. Proc. Nat. Acad. Sci. 95: 14066- 14070, 1998. 2. Chan, J. Y. C., Lerman, M. I., Prabhakar, B. S., Isozaki, O., Santisteban, P., Kuppers, R. C., Oates, E. L., Notkins, A. L., Kohn, L. D. Cloning and characterization of a cDNA that encodes a 70-kDa novel human thyroid autoantigen. J. Biol. Chem. 264: 3651-3654, 1989.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65,149 Da
NCBI Official Full Name
X-ray repair cross-complementing protein 6 isoform 1
NCBI Official Synonym Full Names
X-ray repair complementing defective repair in Chinese hamster cells 6
NCBI Official Symbol
XRCC6
NCBI Official Synonym Symbols
ML8; KU70; TLAA; CTC75; CTCBF; G22P1
NCBI Protein Information
X-ray repair cross-complementing protein 6
UniProt Protein Name
X-ray repair cross-complementing protein 6
UniProt Gene Name
XRCC6
UniProt Synonym Gene Names
G22P1; 5'-dRP lyase Ku70; CTC75; CTCBF; Ku70; TLAA
UniProt Entry Name
XRCC6_HUMAN

NCBI Description

The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus. [provided by RefSeq, Jul 2008]

Uniprot Description

Ku70: a mini-chromosome maintenance protein, essential for the initiation of eukaryotic genome replication. Allows DNA to undergo a single round of replication per cell cycle. Required for the entry in S phase and for cell division.

Protein type: Helicase; EC 3.6.4.-; EC 4.2.99.-; DNA-binding; RNA-binding; Nuclear receptor co-regulator; DNA repair, damage

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: cytosol; membrane; nuclear chromosome, telomeric region; nuclear telomere cap complex; nucleoplasm; nucleus; transcription factor complex

Molecular Function: 5'-deoxyribose-5-phosphate lyase activity; ATP binding; ATP-dependent DNA helicase activity; damaged DNA binding; DNA binding; double-stranded DNA binding; double-stranded telomeric DNA binding; protein binding; protein C-terminus binding

Biological Process: DNA duplex unwinding; DNA ligation; DNA recombination; double-strand break repair via nonhomologous end joining; negative regulation of transcription, DNA-dependent; positive regulation of interferon type I production; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; protein heterotetramerization; regulation of smooth muscle cell proliferation; telomere maintenance; transcription, DNA-dependent

Research Articles on Ku70

Similar Products

Product Notes

The Ku70 xrcc6 (Catalog #AAA178384) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Ku70 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Ku70 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot Concentration: 0.1-0.5ug/ml Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml. Researchers should empirically determine the suitability of the Ku70 xrcc6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Ku70, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.