X-ray repair cross-complementing protein 6 Recombinant Protein | XRCC6/G22P1 recombinant protein

Recombinant Human X-ray repair cross-complementing protein 6

Cat. Num. AAA1265152

• Gene Names: XRCC6; ML8; KU70; TLAA; CTC75; CTCBF; G22P1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: X-ray repair cross-complementing protein 6; Recombinant Human X-ray repair cross-complementing protein 6; 5'-deoxyribose-5-phosphate lyase Ku70; 5'-dRP lyase Ku70; 70 kDa subunit of Ku antigen; ATP-dependent DNA helicase 2 subunit 1; ATP-dependent DNA helicase II 70 kDa subunit; CTC box-binding factor 75 kDa subunit; CTC75; CTCBF; DNA repair protein XRCC6; Lupus Ku autoantigen protein p70; Ku70; Thyroid-lupus autoantigen; TLAA; X-ray repair complementing defective repair in Chinese hamster cells 6; XRCC6/G22P1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 6-222aa; Partial
• Sequence: SYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIIS
• Sequence Length: 609

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for XRCC6/G22P1 recombinant protein

Single-stranded DNA-dependent ATP-dependent helicase. Has a role in chromosome translocation. The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It works in the 3'-5' direction. Binding to DNA may be mediated by XRCC6. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. The XRCC5/6 dimer acts as regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold. The XRCC5/6 dimer is probably involved in stabilizing broken DNA ends and bringing th together. The assembly of the DNA-PK complex to DNA ends is required for the NHEJ ligation step. Required for osteocalcin gene expression. Probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), by catalyzing the beta-elimination of the 5' deoxyribose-5-phosphate at an abasic site near double-strand breaks. 5'-dRP lyase activity allows to 'clean' the termini of abasic sites, a class of nucleotide damage commonly associated with strand breaks, before such broken ends can be joined. The XRCC5/6 dimer together with APEX1 acts as a negative regulator of transcription

Product Categories/Family for XRCC6/G22P1 recombinant protein

Epigenetics and Nuclear Signaling

References

Cloning and characterization of a cDNA that encodes a 70-kDa novel human thyroid autoantigen.Chan J.Y., Lerman M.I., Prabhakar B.S., Isozaki O., Santisteban P., Kuppers R.C., Oates E.L., Notkins A.L., Kohn L.D.J. Biol. Chem. 264:3651-3654(1989)

NCBI and Uniprot Product Information

• NCBI GI #: 573014815
• NCBI GeneID: 2547
• NCBI Accession #: NP_001275905.1
• NCBI GenBank Nucleotide #: NM_001288976.1
• UniProt Accession #: P12956; Q6FG89; Q9UCQ2; Q9UCQ3; B1AHC8
• Molecular Weight: 28.8 kDa
• NCBI Official Full Name: X-ray repair cross-complementing protein 6 isoform 1
• NCBI Official Synonym Full Names: X-ray repair complementing defective repair in Chinese hamster cells 6
• NCBI Official Symbol: XRCC6
• NCBI Official Synonym Symbols: ML8; KU70; TLAA; CTC75; CTCBF; G22P1
• NCBI Protein Information: X-ray repair cross-complementing protein 6
• UniProt Protein Name: X-ray repair cross-complementing protein 6
• Protein Family: X-ray repair cross-complementing protein
• UniProt Gene Name: XRCC6
• UniProt Synonym Gene Names: G22P1; 5'-dRP lyase Ku70; CTC75; CTCBF; Ku70; TLAA
• UniProt Entry Name: XRCC6_HUMAN

NCBI Description

The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus. [provided by RefSeq, Jul 2008]

Uniprot Description

Ku70: a mini-chromosome maintenance protein, essential for the initiation of eukaryotic genome replication. Allows DNA to undergo a single round of replication per cell cycle. Required for the entry in S phase and for cell division.

Protein type: Nuclear receptor co-regulator; Helicase; EC 3.6.4.-; DNA-binding; EC 4.2.99.-; RNA-binding; DNA repair, damage

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: cytosol; membrane; nuclear chromosome, telomeric region; nuclear telomere cap complex; nucleoplasm; nucleus; transcription factor complex

Molecular Function: 5'-deoxyribose-5-phosphate lyase activity; ATP binding; ATP-dependent DNA helicase activity; damaged DNA binding; DNA binding; double-stranded DNA binding; double-stranded telomeric DNA binding; protein binding; protein C-terminus binding

Biological Process: DNA duplex unwinding; DNA ligation; DNA recombination; DNA repair; double-strand break repair; double-strand break repair via nonhomologous end joining; innate immune response; negative regulation of transcription, DNA-dependent; positive regulation of interferon type I production; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; protein heterotetramerization; regulation of smooth muscle cell proliferation; telomere maintenance; transcription, DNA-dependent; viral reproduction