Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-KRT8 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: FilamentsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit KRT8 Polyclonal Antibody | anti-KRT8 antibody

KRT8 Antibody - middle region

Gene Names
KRT8; K8; KO; CK8; CK-8; CYK8; K2C8; CARD2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
KRT8; Polyclonal Antibody; KRT8 Antibody - middle region; anti-KRT8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELES
RLEGLT
Sequence Length
511
Applicable Applications for anti-KRT8 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 92%; Sheep: 92%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human KRT8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-KRT8 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: FilamentsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-KRT8 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: FilamentsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC)

(Rabbit Anti-KRT8 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult ProstateObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-KRT8 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult ProstateObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: RabbitTarget Name: KRT8Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/mlKRT8 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (Host: RabbitTarget Name: KRT8Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/mlKRT8 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-KRT8 antibody
This is a rabbit polyclonal antibody against KRT8. It was validated on Western Blot

Target Description: KRT8 together with KRT19, help to link the contractile apparatus to dystrophin at the costameres of striated muscle.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
keratin, type II cytoskeletal 8 isoform 2
NCBI Official Synonym Full Names
keratin 8
NCBI Official Symbol
KRT8
NCBI Official Synonym Symbols
K8; KO; CK8; CK-8; CYK8; K2C8; CARD2
NCBI Protein Information
keratin, type II cytoskeletal 8
UniProt Protein Name
Keratin, type II cytoskeletal 8
Protein Family
UniProt Gene Name
KRT8
UniProt Synonym Gene Names
CYK8; CK-8; K8
UniProt Entry Name
K2C8_HUMAN

NCBI Description

This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. The product of this gene typically dimerizes with keratin 18 to form an intermediate filament in simple single-layered epithelial cells. This protein plays a role in maintaining cellular structural integrity and also functions in signal transduction and cellular differentiation. Mutations in this gene cause cryptogenic cirrhosis. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

K8: a type II cytoskeletal keratin. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Phosphorylation of keratins at specific sites affects their organization, assembly dynamics, and their interaction with signaling molecules. Phsophorylated by p38 kinase, regulating cellular keratin filament reorganization. Phosphorylation on serine residues is enhanced during EGF stimulation and mitosis. Mutation of this protein is a risk factor for cryptogenic liver failure.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: nucleoplasm; dystrophin-associated glycoprotein complex; intermediate filament cytoskeleton; costamere; nuclear matrix; keratin filament; cytoplasm; intermediate filament; intercellular junction; Z disc; nucleus; sarcolemma

Molecular Function: protein binding; protein complex binding; structural molecule activity

Biological Process: tumor necrosis factor-mediated signaling pathway; viral reproduction; sarcomere organization; response to other organism; response to hydrostatic pressure

Disease: Cirrhosis, Familial

Research Articles on KRT8

Similar Products

Product Notes

The KRT8 krt8 (Catalog #AAA3217090) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KRT8 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KRT8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the KRT8 krt8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLVEDFKNKY EDEINKRTEM ENEFVLIKKD VDEAYMNKVE LES
RL EGLT. It is sometimes possible for the material contained within the vial of "KRT8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.