Western Blot (WB)
(WB Suggested Anti-KRT77 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)
Rabbit KRT77 Polyclonal Antibody | anti-KRT77 antibody
KRT77 Antibody - C-terminal region
Gene Names
KRT77; K1B; KRT1B
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KRT77; Polyclonal Antibody; KRT77 Antibody - C-terminal region; anti-KRT77 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VRTQYELIAQRSKDEAEALYQTKYQELQITAGRHGDDLKNSKMEIAELNR
Sequence Length
578
Applicable Applications for anti-KRT77 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 93%; Pig: 92%; Rabbit: 92%; Rat: 93%; Sheep: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT77
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-KRT77 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)
Western Blot (WB)
(WB Suggested Anti-KRT77 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)
Related Product Information for anti-KRT77 antibody
This is a rabbit polyclonal antibody against KRT77. It was validated on Western Blot
Target Description: Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes an epithelial keratin that is expressed in the skin and eccrine sweat glands. The type II keratins are clustered in a region of chromosome 12q13.
Target Description: Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes an epithelial keratin that is expressed in the skin and eccrine sweat glands. The type II keratins are clustered in a region of chromosome 12q13.
Product Categories/Family for anti-KRT77 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
keratin, type II cytoskeletal 1b
NCBI Official Synonym Full Names
keratin 77
NCBI Official Symbol
KRT77
NCBI Official Synonym Symbols
K1B; KRT1B
NCBI Protein Information
keratin, type II cytoskeletal 1b
UniProt Protein Name
Keratin, type II cytoskeletal 1b
Protein Family
UniProt Gene Name
KRT77
UniProt Synonym Gene Names
KRT1B; CK-1B; K77
UniProt Entry Name
K2C1B_HUMAN
NCBI Description
Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes an epithelial keratin that is expressed in the skin and eccrine sweat glands. The type II keratins are clustered in a region of chromosome 12q13.[provided by RefSeq, Jun 2009]
Uniprot Description
K77: Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes an epithelial keratin that is expressed in the skin and eccrine sweat glands. The type II keratins are clustered in a region of chromosome 12q13.[provided by RefSeq, Jun 2009]
Protein type: Cytoskeletal
Chromosomal Location of Human Ortholog: 12q13.13
Cellular Component: cytoskeleton
Research Articles on KRT77
Similar Products
Product Notes
The KRT77 krt77 (Catalog #AAA3217091) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KRT77 Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's KRT77 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KRT77 krt77 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VRTQYELIAQ RSKDEAEALY QTKYQELQIT AGRHGDDLKN SKMEIAELNR. It is sometimes possible for the material contained within the vial of "KRT77, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
