Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Citrate synthase Recombinant Protein | CS recombinant protein

Recombinant Human Citrate synthase, mitochondrial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Citrate synthase; Recombinant Human Citrate synthase; mitochondrial; Citrate (Si)-synthase; CS recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
28-464aa; Partial
Sequence
ASSTNLKDILADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSESNFARAYAQGISRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSK
Sequence Length
466
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Product Categories/Family for CS recombinant protein
References
Cloning and molecular analysis of the human citrate synthase gene.Goldenthal M.J., Marin-Garcia J., Ananthakrishnan R.Genome 41:733-738(1998)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52.9 kDa
NCBI Official Full Name
citrate synthase, mitochondrial
NCBI Official Synonym Full Names
citrate synthase
NCBI Official Symbol
CS
NCBI Protein Information
citrate synthase, mitochondrial
UniProt Protein Name
Citrate synthase, mitochondrial
Protein Family
UniProt Gene Name
CS
UniProt Entry Name
CISY_HUMAN

NCBI Description

The protein encoded by this gene is a Krebs tricarboxylic acid cycle enzyme that catalyzes the synthesis of citrate from oxaloacetate and acetyl coenzyme A. The enzyme is found in nearly all cells capable of oxidative metablism. This protein is nuclear encoded and transported into the mitochondrial matrix, where the mature form is found. [provided by RefSeq, Jul 2008]

Uniprot Description

CS: a mitochondrial enzyme of the tricarboxylic acid cycle that converts acetyl-CoA + H2O + oxaloacetate into citrate + CoA. Found in nearly all cells capable of oxidative metabolism.

Protein type: Transferase; Carbohydrate Metabolism - citrate (TCA) cycle; Mitochondrial; Carbohydrate Metabolism - glyoxylate and dicarboxylate; EC 2.3.3.1

Chromosomal Location of Human Ortholog: 12q13.2

Cellular Component: mitochondrial matrix; mitochondrion; nucleus

Molecular Function: citrate (Si)-synthase activity

Biological Process: carbohydrate metabolic process; cellular metabolic process; tricarboxylic acid cycle

Research Articles on CS

Similar Products

Product Notes

The CS cs (Catalog #AAA1146396) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-464aa; Partial. The amino acid sequence is listed below: ASSTNLKDIL ADLIPKEQAR IKTFRQQHGK TVVGQITVDM MYGGMRGMKG LVYETSVLDP DEGIRFRGFS IPECQKLLPK AKGGEEPLPE GLFWLLVTGH IPTEEQVSWL SKEWAKRAAL PSHVVTMLDN FPTNLHPMSQ LSAAVTALNS ESNFARAYAQ GISRTKYWEL IYEDSMDLIA KLPCVAAKIY RNLYREGSGI GAIDSNLDWS HNFTNMLGYT DHQFTELTRL YLTIHSDHEG GNVSAHTSHL VGSALSDPYL SFAAAMNGLA GPLHGLANQE VLVWLTQLQK EVGKDVSDEK LRDYIWNTLN SGRVVPGYGH AVLRKTDPRY TCQREFALKH LPNDPMFKLV AQLYKIVPNV LLEQGKAKNP WPNVDAHSGV LLQYYGMTEM NYYTVLFGVS RALGVLAQLI WSRALGFPLE RPKSMSTEGL MKFVDSK. It is sometimes possible for the material contained within the vial of "Citrate synthase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.